From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004164000
  • symbol?: grpE
  • description?: heat shock protein GrpE

      descriptions from strain specific annotations:

    • heat shock protein GrpE
    • nucleotide exchange factor GrpE
    • GrpE protein (Hsp-70 cofactor)
    • co-chaperone GrpE
    • Grpe
    • heat shock molecular chaperone protein
    • protein grpE (HSP-70 cofactor)
  • strand?: -
  • coordinates?: 4430365..4430991
  • synteny block?: BlockID0031940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1638 (grpE)
    N315:
    SA1410 (grpE)
    NCTC8325:
    Newman:
    NWMN_1484 (grpE)
    USA300_FPR3757:
    04-02981:
    SA2981_1539 (grpE)
    08BA02176:
    C248_1624 (grpE)
    11819-97:
    MS7_1598 (grpE)
    71193:
    ST398NM01_1647
    ECT-R 2:
    ECTR2_1431
    ED133:
    SAOV_1581 (grpE)
    ED98:
    SAAV_1573 (grpE)
    HO 5096 0412:
    SAEMRSA15_15010 (grpE)
    JH1:
    SaurJH1_1673
    JH9:
    SaurJH9_1639
    JKD6008:
    SAA6008_01551 (grpE)
    JKD6159:
    SAA6159_01516 (grpE)
    LGA251:
    SARLGA251_14870 (grpE)
    M013:
    M013TW_1596
    MRSA252:
    SAR1658 (grpE)
    MSHR1132:
    SAMSHR1132_14210
    MSSA476:
    SAS1519
    Mu3:
    SAHV_1568 (grpE)
    Mu50:
    SAV1581 (grpE)
    MW2:
    MW1533 (grpE)
    RF122:
    SAB1453c (grpE)
    ST398:
    SAPIG1647 (grpE)
    T0131:
    SAT0131_01677
    TCH60:
    HMPREF0772_11559 (grpE)
    TW20:
    SATW20_15770 (grpE)
    USA300_TCH1516:
    USA300HOU_1582 (grpE)
    VC40:
    SAVC_07160

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNKDESVKKNTESTVEETNVKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKD
    N315            MTNKDESVEKNTESTVEETNIKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKD
    NCTC8325        MTNKDESVEKNTESTVEETNVKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKD
    Newman          MTNKDESVEKNTESTVEETNVKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKD
    USA300_FPR3757  MTNKDESVEKNTESTVEETNVKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKD
                    ********:***********:***************************************

    COL             QKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERA
    N315            QKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERA
    NCTC8325        QKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERA
    Newman          QKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERA
    USA300_FPR3757  QKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERA
                    ************************************************************

    COL             LQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFE
    N315            LQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFE
    NCTC8325        LQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFE
    Newman          LQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFE
    USA300_FPR3757  LQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFE
                    ************************************************************

    COL             SGEITQELQKGYKLKDRVLRPSMVKVNQ
    N315            SGEITQELQKGYKLKDRVLRPSMVKVNQ
    NCTC8325        SGEITQELQKGYKLKDRVLRPSMVKVNQ
    Newman          SGEITQELQKGYKLKDRVLRPSMVKVNQ
    USA300_FPR3757  SGEITQELQKGYKLKDRVLRPSMVKVNQ
                    ****************************