From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1410 [new locus tag: SA_RS07960 ]
  • pan locus tag?: SAUPAN004164000
  • symbol: grpE
  • pan gene symbol?: grpE
  • synonym:
  • product: heat shock protein GrpE

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1410 [new locus tag: SA_RS07960 ]
  • symbol: grpE
  • product: heat shock protein GrpE
  • replicon: chromosome
  • strand: -
  • coordinates: 1615415..1616041
  • length: 627
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACAAATAAAGACGAATCAGTTGAAAAAAACACTGAATCAACAGTTGAAGAAACAAAC
    ATCAAACAAAATATTGATGATTCAGTTGAACAAGCTGAAGAAAGTAAAGGTCATTTACAA
    GATGAAGCAATAGAAGAAACGTCTGACGAGAATGTTATTGAAGAAATAGATCCAAAAGAT
    CAAAAAATTAATGAACTTCAACAATTAGCAGATGAAAACGAAGAGAAATATTTAAGGCTC
    TACGCTGAGTTTGAAAATTATAAGCGTAGAATTCAAAAAGAAAATGAAATAAATAAAACA
    TATCAAGCACAACGTGTGTTAACAGATATTTTACCAGCAATAGACAATATAGAACGTGCA
    CTTCAAATTGAAGGTGATGATGAGACTTTTAAATCTCTTCAAAAAGGTGTACAAATGGTG
    CATGAAAGTTTGATTAACGCACTAAAAGATAATGGTCTTGAAGTTATTAAAACTGAAGGT
    GAAGCATTTGATCCAAATATTCACCAAGCTGTAGTTCAAGATGATAACCCTGATTTTGAA
    TCTGGCGAAATCACTCAAGAACTACAAAAAGGATACAAGCTTAAAGATAGAGTATTAAGA
    CCATCAATGGTCAAAGTAAACCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1410 [new locus tag: SA_RS07960 ]
  • symbol: GrpE
  • description: heat shock protein GrpE
  • length: 208
  • theoretical pI: 4.14169
  • theoretical MW: 24022.2
  • GRAVY: -1.03269

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    chain length determinant protein EpsF (TIGR03017; HMM-score: 9.7)
  • TheSEED:  
    Protein MetabolismProtein foldingProtein chaperones Heat shock protein GrpE 
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended Heat shock protein GrpE 
  • PFAM:
    no clan definedGrpE; GrpE (PF01025; HMM-score: 162.5)
    RPW8; Arabidopsis broad-spectrum mildew resistance protein RPW8 (PF05659; HMM-score: 12.3)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 6.4)
    DUF4047; Domain of unknown function (DUF4047) (PF13256; HMM-score: 6.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 33
    • Cmax: 0.147
    • Cmax_pos: 33
    • Smax: 0.191
    • Smax_pos: 5
    • Smean: 0.103
    • D: 0.115
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNKDESVEKNTESTVEETNIKQNIDDSVEQAEESKGHLQDEAIEETSDENVIEEIDPKDQKINELQQLADENEEKYLRLYAEFENYKRRIQKENEINKTYQAQRVLTDILPAIDNIERALQIEGDDETFKSLQKGVQMVHESLINALKDNGLEVIKTEGEAFDPNIHQAVVQDDNPDFESGEITQELQKGYKLKDRVLRPSMVKVNQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: CtsR, HrcA
    CtsR (TF) important in Heat shock responseRegPrecise
    HrcA (TF) important in Heat shock responseRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)