From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1408 [new locus tag: SA_RS07950 ]
  • pan locus tag?: SAUPAN004162000
  • symbol: dnaJ
  • pan gene symbol?: dnaJ
  • synonym:
  • product: molecular chaperone DnaJ

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1408 [new locus tag: SA_RS07950 ]
  • symbol: dnaJ
  • product: molecular chaperone DnaJ
  • replicon: chromosome
  • strand: -
  • coordinates: 1612239..1613378
  • length: 1140
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    GTGGCCAAAAGAGACTATTATGAAGTTTTAGGCATTAGTAAAGATGCTTCAAAAGATGAA
    ATCAAAAAAGCGTATCGAAAGCTTTCGAAAAAATATCATCCAGATATTAACAAAGAAGAA
    GGTGCAGATGAAAAGTTTAAAGAAATTTCTGAAGCCTATGAAGTTTTAAGTGATGATAAT
    AAACGCGCAAGCTATGATCAATTTGGACATGATGGTCCACAAGGTTTTGGTGGACAAGGA
    TTCAATGGCTCTGACTTTGGCGGTTTTAGTGGCTTCGGTGGCGGCGGTTTTGAAGATATC
    TTTAGCTCTTTCTTCGGTGGCGGCAGACAAAGAGATCCAAATGCACCGCAAAAAGGTGAT
    GATCTTCAGTATACAATGACATTAACATTTGAAGAAGCGGTATTTGGTACAACAAAAGAA
    ATTTCAATCCGTAAAGATGTAACATGCGAAACATGTCATGGTGATGGTGCAAAGCCTGGA
    ACAAGTAAAAAGACTTGTAGTTACTGTAATGGCGCTGGTCATGTAGCTGTAGAACAAAAC
    ACAATTTTAGGTAGAGTTCGTACTGAACAAGTTTGTCCTAAATGTAATGGAAGTGGTCAA
    GAATTTGAAGAAGCTTGTCCAACATGTCACGGAAAAGGTACTGAAAATAAAACAGTTAAA
    TTAGAAGTGAAAGTACCTGAAGGTGTCGACAATGAACAACAAATTAGATTAGCTGGTGAA
    GGCTCTCCAGGCGTGAATGGAGGACCTGCTGGTGATTTATACGTAGTATTTAGAGTTAAA
    CCATCTGAAACATTTAAACGTGATGGTGATGATATTTATTACAAATTAAATGTTAGCTTC
    CCACAAGCAGCTTTAGGCGATGAAATAAAAATACCAACATTAAATAATGAAGTTATGTTA
    ACAATCCCTGCTGGTACACAAACAGGTAAGCAATTCCGCTTAAAAGAAAAGGGTATAAAA
    AATGTTCATGGCTATGGATACGGAGATTTATATGTTGATATTAAAGTAGTAACGCCTACT
    AAATTAACAGATAGACAAAAAGAACTAATGAAAGAATTTGCCCAATTAAATGGTGAAGAA
    ATTAATGAACAACCTTCGAATTTTAAAGATAGAGCAAAAAGATTCTTTAAGGGAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1408 [new locus tag: SA_RS07950 ]
  • symbol: DnaJ
  • description: molecular chaperone DnaJ
  • length: 379
  • theoretical pI: 5.79
  • theoretical MW: 41760.2
  • GRAVY: -0.783641

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    chaperone protein DnaJ (TIGR02349; HMM-score: 466)
    Cellular processesCellular processesChemotaxis and motilityterminal organelle assembly protein TopJ (TIGR03835; HMM-score: 157)
    Genetic information processingProtein fateProtein folding and stabilizationFe-S protein assembly co-chaperone HscB (TIGR00714; HMM-score: 21.4)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsuncharacterized phage protein (TIGR02642; HMM-score: 14.5)
    Genetic information processingProtein fateProtein modification and repairhydrogenase nickel insertion protein HypA (TIGR00100; HMM-score: 5.7)
  • TheSEED:  
    Protein MetabolismProtein foldingProtein chaperones Chaperone protein DnaJ 
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended Chaperone protein DnaJ 
  • PFAM:
    no clan definedDnaJ_C; DnaJ C terminal domain (PF01556; HMM-score: 151.9)
    Chaperone-J (CL0392) DnaJ; DnaJ domain (PF00226; HMM-score: 97.3)
    no clan definedDnaJ_CXXCXGXG; DnaJ central domain (PF00684; HMM-score: 51.2)
    C2H2-zf (CL0361) zf-C2H2_10; C2H2 zinc-finger (PF16588; HMM-score: 20.2)
    no clan definedAnti-TRAP; Tryptophan RNA-binding attenuator protein inhibitory protein (PF15777; HMM-score: 19)
    Cytochrome-c (CL0318) CCP_MauG; Di-haem cytochrome c peroxidase (PF03150; HMM-score: 13.9)
    Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 13.7)
    no clan definedDUF3365; Protein of unknown function (DUF3365) (PF11845; HMM-score: 12.9)
    Multiheme_cytos (CL0317) Cytochrome_C554; Cytochrome c554 and c-prime (PF13435; HMM-score: 12)
    no clan definedDUF5351; Family of unknown function (DUF5351) (PF17302; HMM-score: 11.9)
    Multiheme_cytos (CL0317) Cytochrom_c3_2; Cytochrome c3 (PF14537; HMM-score: 11.9)
    Cytochrome-c (CL0318) Cytochrome_CBB3; Cytochrome C oxidase, cbb3-type, subunit III (PF13442; HMM-score: 10.9)
    RING (CL0229) zf-C3HC4_3; Zinc finger, C3HC4 type (RING finger) (PF13920; HMM-score: 10.4)
    no clan definedHypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 9.2)
    Cytochrome-c (CL0318) DUF1924; Domain of unknown function (DUF1924) (PF09086; HMM-score: 9.2)
    Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 9)
    RING (CL0229) zf-RING_10; zinc RING finger of MSL2 (PF16685; HMM-score: 6.9)
    no clan definedzf-CHY; CHY zinc finger (PF05495; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.105
    • Ymax_pos: 25
    • Cmax: 0.109
    • Cmax_pos: 43
    • Smax: 0.138
    • Smax_pos: 16
    • Smean: 0.085
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDNKRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQNTILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGEGSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVMLTIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEEINEQPSNFKDRAKRFFKGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: CtsR, HrcA
    CtsR (TF) important in Heat shock responseRegPrecise
    HrcA (TF) important in Heat shock responseRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]