From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004162000
  • symbol?: dnaJ
  • description?: molecular chaperone DnaJ

      descriptions from strain specific annotations:

    • molecular chaperone DnaJ
    • chaperone protein DnaJ
    • DnaJ protein
  • strand?: -
  • coordinates?: 4427183..4428322
  • synteny block?: BlockID0031920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1636 (dnaJ)
    N315:
    SA1408 (dnaJ)
    NCTC8325:
    Newman:
    NWMN_1482 (dnaJ)
    USA300_FPR3757:
    04-02981:
    SA2981_1537 (dnaJ)
    08BA02176:
    C248_1622 (dnaJ)
    11819-97:
    MS7_1596 (dnaJ)
    71193:
    ST398NM01_1645
    ECT-R 2:
    ECTR2_1429 (dnaJ)
    ED133:
    SAOV_1579
    ED98:
    SAAV_1571 (dnaJ)
    HO 5096 0412:
    SAEMRSA15_14990 (dnaJ)
    JH1:
    SaurJH1_1671
    JH9:
    SaurJH9_1637
    JKD6008:
    SAA6008_01549 (dnaJ)
    JKD6159:
    SAA6159_01514 (dnaJ)
    LGA251:
    SARLGA251_14850 (dnaJ)
    M013:
    M013TW_1594
    MRSA252:
    SAR1656 (dnaJ)
    MSHR1132:
    SAMSHR1132_14190
    MSSA476:
    SAS1517
    Mu3:
    SAHV_1566 (dnaJ)
    Mu50:
    SAV1579 (dnaJ)
    MW2:
    MW1531 (dnaJ)
    RF122:
    SAB1451c (dnaJ)
    ST398:
    SAPIG1645 (dnaJ)
    T0131:
    SAT0131_01675
    TCH60:
    HMPREF0772_11561 (dnaJ)
    TW20:
    SATW20_15750 (dnaJ)
    USA300_TCH1516:
    USA300HOU_1580 (dnaJ)
    VC40:
    SAVC_07145

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDN
    N315            MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDN
    NCTC8325        MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDN
    Newman          MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDN
    USA300_FPR3757  MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDN
                    ************************************************************

    COL             KRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGD
    N315            KRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGD
    NCTC8325        KRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGD
    Newman          KRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGD
    USA300_FPR3757  KRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGD
                    ************************************************************

    COL             DLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQN
    N315            DLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQN
    NCTC8325        DLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQN
    Newman          DLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQN
    USA300_FPR3757  DLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQN
                    ************************************************************

    COL             TILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGE
    N315            TILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGE
    NCTC8325        TILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGE
    Newman          TILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGE
    USA300_FPR3757  TILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGE
                    ************************************************************

    COL             GSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVML
    N315            GSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVML
    NCTC8325        GSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVML
    Newman          GSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVML
    USA300_FPR3757  GSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVML
                    ************************************************************

    COL             TIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEE
    N315            TIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEE
    NCTC8325        TIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEE
    Newman          TIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEE
    USA300_FPR3757  TIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEE
                    ************************************************************

    COL             INEQPSNFKDRAKRFFKGE
    N315            INEQPSNFKDRAKRFFKGE
    NCTC8325        INEQPSNFKDRAKRFFKGE
    Newman          INEQPSNFKDRAKRFFKGE
    USA300_FPR3757  INEQPSNFKDRAKRFFKGE
                    *******************