From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01682
  • pan locus tag?: SAUPAN004162000
  • symbol: SAOUHSC_01682
  • pan gene symbol?: dnaJ
  • synonym:
  • product: chaperone protein DnaJ

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01682
  • symbol: SAOUHSC_01682
  • product: chaperone protein DnaJ
  • replicon: chromosome
  • strand: -
  • coordinates: 1591338..1592477
  • length: 1140
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    GTGGCCAAAAGAGATTATTATGAAGTTTTAGGCATTAGTAAGGATGCTTCAAAAGATGAA
    ATCAAAAAAGCGTATCGAAAGCTTTCGAAAAAATATCATCCAGATATTAACAAAGAAGAA
    GGTGCAGATGAAAAGTTTAAAGAAATTTCTGAAGCCTATGAAGTTTTAAGTGATGATAAT
    AAACGCGCAAGCTATGATCAATTTGGACATGATGGTCCACAAGGTTTTGGTGGACAAGGA
    TTCAATGGCTCTGACTTTGGCGGTTTTAGTGGCTTCGGTGGCGGCGGTTTTGAAGATATC
    TTTAGCTCTTTCTTCGGTGGCGGCAGACAAAGAGATCCAAATGCACCGCAAAAAGGTGAT
    GATCTTCAGTATACAATGACATTAACATTTGAAGAAGCGGTATTTGGTACAACAAAAGAA
    ATTTCAATCCGTAAAGATGTAACATGCGAAACATGTCATGGTGATGGTGCAAAGCCTGGA
    ACAAGTAAAAAGACTTGTAGTTACTGTAATGGCGCTGGTCATGTAGCTGTAGAACAAAAC
    ACAATTTTAGGTAGAGTTCGTACTGAACAAGTTTGTCCTAAATGTAATGGAAGTGGTCAA
    GAATTTGAAGAAGCTTGTCCAACATGTCACGGAAAAGGTACTGAAAATAAAACAGTTAAA
    TTAGAAGTGAAAGTACCTGAAGGTGTCGACAATGAACAACAAATTAGATTAGCTGGTGAA
    GGCTCTCCAGGCGTGAATGGAGGACCTGCTGGTGATTTATACGTAGTATTTAGAGTTAAA
    CCATCTGAAACATTTAAACGTGATGGTGATGATATTTATTACAAATTAAATGTTAGCTTC
    CCACAAGCAGCTTTAGGCGATGAAATAAAAATACCAACATTAAATAATGAAGTTATGTTA
    ACAATCCCTGCTGGTACACAAACAGGTAAGCAATTCCGCTTAAAAGAAAAGGGTATAAAA
    AATGTTCATGGCTATGGATACGGAGATTTATATGTTGATATTAAAGTAGTAACGCCTACT
    AAATTAACAGATAGACAAAAAGAACTAATGAAAGAATTTGCCCAATTAAATGGTGAAGAA
    ATTAATGAACAACCTTCGAATTTTAAAGATAGAGCAAAAAGATTCTTTAAGGGAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01682
  • symbol: SAOUHSC_01682
  • description: chaperone protein DnaJ
  • length: 379
  • theoretical pI: 5.79
  • theoretical MW: 41760.2
  • GRAVY: -0.783641

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    chaperone protein DnaJ (TIGR02349; HMM-score: 466)
    Cellular processesCellular processesChemotaxis and motilityterminal organelle assembly protein TopJ (TIGR03835; HMM-score: 157)
    Genetic information processingProtein fateProtein folding and stabilizationFe-S protein assembly co-chaperone HscB (TIGR00714; HMM-score: 21.4)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsuncharacterized phage protein (TIGR02642; HMM-score: 14.5)
    Genetic information processingProtein fateProtein modification and repairhydrogenase nickel insertion protein HypA (TIGR00100; HMM-score: 5.7)
  • TheSEED:  
    Protein MetabolismProtein foldingProtein chaperones Chaperone protein DnaJ 
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended Chaperone protein DnaJ 
  • PFAM:
    no clan definedDnaJ_C; DnaJ C terminal domain (PF01556; HMM-score: 151.9)
    Chaperone-J (CL0392) DnaJ; DnaJ domain (PF00226; HMM-score: 97.3)
    no clan definedDnaJ_CXXCXGXG; DnaJ central domain (PF00684; HMM-score: 51.2)
    C2H2-zf (CL0361) zf-C2H2_10; C2H2 zinc-finger (PF16588; HMM-score: 20.2)
    no clan definedAnti-TRAP; Tryptophan RNA-binding attenuator protein inhibitory protein (PF15777; HMM-score: 19)
    Cytochrome-c (CL0318) CCP_MauG; Di-haem cytochrome c peroxidase (PF03150; HMM-score: 13.9)
    Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 13.7)
    no clan definedDUF3365; Protein of unknown function (DUF3365) (PF11845; HMM-score: 12.9)
    Multiheme_cytos (CL0317) Cytochrome_C554; Cytochrome c554 and c-prime (PF13435; HMM-score: 12)
    no clan definedDUF5351; Family of unknown function (DUF5351) (PF17302; HMM-score: 11.9)
    Multiheme_cytos (CL0317) Cytochrom_c3_2; Cytochrome c3 (PF14537; HMM-score: 11.9)
    Cytochrome-c (CL0318) Cytochrome_CBB3; Cytochrome C oxidase, cbb3-type, subunit III (PF13442; HMM-score: 10.9)
    RING (CL0229) zf-C3HC4_3; Zinc finger, C3HC4 type (RING finger) (PF13920; HMM-score: 10.4)
    no clan definedHypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 9.2)
    Cytochrome-c (CL0318) DUF1924; Domain of unknown function (DUF1924) (PF09086; HMM-score: 9.2)
    Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 9)
    RING (CL0229) zf-RING_10; zinc RING finger of MSL2 (PF16685; HMM-score: 6.9)
    no clan definedzf-CHY; CHY zinc finger (PF05495; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.105
    • Ymax_pos: 25
    • Cmax: 0.109
    • Cmax_pos: 43
    • Smax: 0.138
    • Smax_pos: 16
    • Smean: 0.085
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDNKRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQNTILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGEGSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVMLTIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEEINEQPSNFKDRAKRFFKGE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SAOUHSC_01685 (HrcA*)
    HrcA* (TF) important in Heat shock response

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]