From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004171000
  • symbol?: lepA
  • description?: GTP-binding protein LepA

      descriptions from strain specific annotations:

    • GTP-binding protein LepA
    • Translation elongation factor LepA
    • putative GTP-binding protein
    • GTP binding protein
    • elongation factor Tu GTP binding domain-containing protein
  • strand?: -
  • coordinates?: 4434332..4436156
  • synteny block?: BlockID0032010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1641 (lepA)
    N315:
    SA1413 (lepA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1543 (lepA)
    08BA02176:
    C248_1627 (lepA)
    11819-97:
    MS7_1602 (lepA)
    71193:
    ST398NM01_1650
    ECT-R 2:
    ECTR2_1434 (lepA)
    ED133:
    SAOV_1584 (lepA)
    ED98:
    SAAV_1576 (lepA)
    HO 5096 0412:
    SAEMRSA15_15040 (lepA)
    JH1:
    SaurJH1_1677
    JH9:
    SaurJH9_1642
    JKD6008:
    SAA6008_01554 (lepA)
    JKD6159:
    SAA6159_01520 (lepA)
    LGA251:
    SARLGA251_14900 (lepA)
    M013:
    M013TW_1599
    MRSA252:
    SAR1662 (lepA)
    MSHR1132:
    SAMSHR1132_14240
    MSSA476:
    SAS1522
    Mu3:
    SAHV_1572 (lepA)
    Mu50:
    SAV1585 (lepA)
    MW2:
    MW1536 (lepA)
    RF122:
    SAB1457c (lepA)
    ST398:
    SAPIG1650 (lepA)
    T0131:
    SAT0131_01680 (ctsR)
    TCH60:
    HMPREF0772_11556 (lepA)
    TW20:
    SATW20_15800 (lepA)
    USA300_TCH1516:
    USA300HOU_1586 (lepA)
    VC40:
    SAVC_07180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNEQRLKRRENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERG
    N315            MDNEQRLKRRENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERG
    NCTC8325        MDNEQRLKRRENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERG
    Newman          MDNEQRLKRRENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERG
    USA300_FPR3757  MDNEQRLKRRENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERG
                    ************************************************************

    COL             ITIKLNAVRLKYEAKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
    N315            ITIKLNAVRLKYEAKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
    NCTC8325        ITIKLNAVRLKYEAKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
    Newman          ITIKLNAVRLKYEAKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
    USA300_FPR3757  ITIKLNAVRLKYEAKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
                    ************************************************************

    COL             TLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEE
    N315            TLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEE
    NCTC8325        TLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEE
    Newman          TLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEE
    USA300_FPR3757  TLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEE
                    ************************************************************

    COL             ILEKIVEVVPAPDGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKE
    N315            ILEKIVEVVPAPDGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKE
    NCTC8325        ILEKIVEVVPAPDGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKE
    Newman          ILEKIVEVVPAPDGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKE
    USA300_FPR3757  ILEKIVEVVPAPDGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKE
                    ************************************************************

    COL             FEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKM
    N315            FEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKM
    NCTC8325        FEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKM
    Newman          FEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKM
    USA300_FPR3757  FEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKM
                    ************************************************************

    COL             NPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEII
    N315            NPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEII
    NCTC8325        NPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEII
    Newman          NPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEII
    USA300_FPR3757  NPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEII
                    ************************************************************

    COL             QERIEREFGIELIATAPSVIYQCVLRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVP
    N315            QERIEREFGIELIATAPSVIYQCILRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVP
    NCTC8325        QERIEREFGIELIATAPSVIYQCVLRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVP
    Newman          QERIEREFGIELIATAPSVIYQCVLRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVP
    USA300_FPR3757  QERIEREFGIELIATAPSVIYQCVLRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVP
                    ***********************:************************************

    COL             NDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDY
    N315            NDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDY
    NCTC8325        NDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDY
    Newman          NDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDY
    USA300_FPR3757  NDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDY
                    ************************************************************

    COL             EFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQA
    N315            EFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQA
    NCTC8325        EFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQA
    Newman          EFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQA
    USA300_FPR3757  EFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQA
                    ************************************************************

    COL             AIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLA
    N315            AIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLA
    NCTC8325        AIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLA
    Newman          AIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLA
    USA300_FPR3757  AIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLA
                    ************************************************************

    COL             VLKMDDE
    N315            VLKMDDE
    NCTC8325        VLKMDDE
    Newman          VLKMDDE
    USA300_FPR3757  VLKMDDE
                    *******