From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004173000
  • symbol?: holA
  • description?: DNA polymerase III subunit delta

      descriptions from strain specific annotations:

    • DNA polymerase III subunit delta
    • DNA-directed DNA polymerase III subunit delta
    • DNA polymerase III, delta subunit
    • DNA polymerase III delta subunit
  • strand?: -
  • coordinates?: 4436803..4437777
  • synteny block?: BlockID0032030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1643 (holA)
    N315:
    SA1415 (holA)
    NCTC8325:
    Newman:
    NWMN_1489 (holA)
    USA300_FPR3757:
    04-02981:
    SA2981_1545
    08BA02176:
    C248_1629 (holA)
    11819-97:
    MS7_1604 (holA)
    71193:
    ST398NM01_1652
    ECT-R 2:
    ECTR2_1436 (holA)
    ED133:
    SAOV_1586
    ED98:
    SAAV_1578 (holA)
    HO 5096 0412:
    SAEMRSA15_15060
    JH1:
    SaurJH1_1679 (holA)
    JH9:
    SaurJH9_1644 (holA)
    JKD6008:
    SAA6008_01556 (holA)
    JKD6159:
    SAA6159_01522 (holA)
    LGA251:
    SARLGA251_14920
    M013:
    M013TW_1601
    MRSA252:
    SAR1664 (holA)
    MSHR1132:
    SAMSHR1132_14260
    MSSA476:
    SAS1524 (holA)
    Mu3:
    SAHV_1574 (holA)
    Mu50:
    SAV1587 (holA)
    MW2:
    MW1538 (holA)
    RF122:
    SAB1459c (holA)
    ST398:
    SAPIG1652 (holA)
    T0131:
    SAT0131_01682
    TCH60:
    HMPREF0772_11554 (holA)
    TW20:
    SATW20_15820
    USA300_TCH1516:
    USA300HOU_1588 (holA)
    VC40:
    SAVC_07190 (holA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDNIVAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYETEIAPIVEETLTLPFF
    N315            MSDNIVAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYEKEIAPIVEETLTLPFF
    NCTC8325        MSDNIVAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYETEIAPIVEETLTLPFF
    Newman          MSDNIVAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYETEIAPIVEETLTLPFF
    USA300_FPR3757  MSDNIVAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYETEIAPIVEETLTLPFF
                    ********************************************.***************

    COL             SDKKAILVKNAYIFTGEKAPKDMAHNVDQLIEFIEKYDGENLIVFEIYQNKLDERKKLTK
    N315            SDKKAILVKNAYIFTGEKAPKDMAHNVDQLIEFIEKYDGENLIVFEIYQNKLDERKKLTK
    NCTC8325        SDKKAILVKNAYIFTGEKAPKDMAHNVDQLIEFIEKYDGENLIVFEIYQNKLDERKKLTK
    Newman          SDKKAILVKNAYIFTGEKAPKDMAHNVDQLIEFIEKYDGENLIVFEIYQNKLDERKKLTK
    USA300_FPR3757  SDKKAILVKNAYIFTGEKAPKDMAHNVDQLIEFIEKYDGENLIVFEIYQNKLDERKKLTK
                    ************************************************************

    COL             TLKKHARLKKIEQMSEEEIKKWIQSKLNENFKDIKRDALDLFIELTGINFNIVSQEIEKL
    N315            TLKKHARLKKIEQMSEEEIKKWIQSKLNENFKDIKRDALDLFIELTGINFNIVSQEIEKL
    NCTC8325        TLKKHARLKKIEQMSEEEIKKWIQSKLNENFKDIKRDALDLFIELTGINFNIVSQEIEKL
    Newman          TLKKHARLKKIEQMSEEEIKKWIQSKLNENFKDIKRDALDLFIELTGINFNIVSQEIEKL
    USA300_FPR3757  TLKKHARLKKIEQMSEEEIKKWIQSKLNENFKDIKRDALDLFIELTGINFNIVSQEIEKL
                    ************************************************************

    COL             ILFLGDRPTINKQDVNQIINRSLEQNVFLLTEYIQKRKKEQAIHLVKDLITMKEEPIKLL
    N315            ILFLGDRPTINKQDVNQIINRSLEQNVFLLTEYIQKRKKEQAIHLVKDLITMKEEPIKLL
    NCTC8325        ILFLGDRPTINKQDVNQIINRSLEQNVFLLTEYIQKRKKEQAIHLVKDLITMKEEPIKLL
    Newman          ILFLGDRPTINKQDVNQIINRSLEQNVFLLTEYIQKRKKEQAIHLVKDLITMKEEPIKLL
    USA300_FPR3757  ILFLGDRPTINKQDVNQIINRSLEQNVFLLTEYIQKRKKEQAIHLVKDLITMKEEPIKLL
                    ************************************************************

    COL             ALITSNYRLFYQCKILSQKGYSGQQIAKTIGVHPYRVKLALGQVRHYQLDELLNIIDACA
    N315            ALITSNYRLFYQCKILSQKGYSGQQIAKTIGVHPYRVKLALGQVRHYQLDELLNIVDACA
    NCTC8325        ALITSNYRLFYQCKILSQKGYSGQQIAKTIGVHPYRVKLALGQVRHYQLDELLNIIDACA
    Newman          ALITSNYRLFYQCKILSQKGYSGQQIAKTIGVHPYRVKLALGQVRHYQLDELLNIIDACA
    USA300_FPR3757  ALITSNYRLFYQCKILSQKGYSGQQIAKTIGVHPYRVKLALGQVRHYQLDELLNIIDACA
                    *******************************************************:****

    COL             ETDYKLKSSYMDKQLILELFILSL
    N315            ETDYKLKSSYMDKQLILELFILSL
    NCTC8325        ETDYKLKSSYMDKQLILELFILSL
    Newman          ETDYKLKSSYMDKQLILELFILSL
    USA300_FPR3757  ETDYKLKSSYMDKQLILELFILSL
                    ************************