From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004174000
  • symbol?: comEC
  • description?: DNA internalization-related competence protein ComEC/Rec2

      descriptions from strain specific annotations:

    • DNA internalization-related competence protein ComEC/Rec2
    • competence protein ComEC/Rec2
    • Late competence protein ComEC, DNA transport
    • COME operon protein 3
    • late competence protein ComEC
    • pseudogene
  • strand?: -
  • coordinates?: 4437834..4439953
  • synteny block?: BlockID0032040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1490 (comEC)
    USA300_FPR3757:
    04-02981:
    SA2981_1546 (comEC)
    08BA02176:
    C248_1630
    11819-97:
    MS7_1605
    71193:
    ST398NM01_1653
    ECT-R 2:
    ECTR2_1437
    ED133:
    SAOV_1587
    ED98:
    SAAV_1579
    HO 5096 0412:
    SAEMRSA15_15070
    JH1:
    SaurJH1_1680
    JH9:
    SaurJH9_1645
    JKD6008:
    SAA6008_01557 (comEC)
    JKD6159:
    SAA6159_01523 (comEC)
    LGA251:
    SARLGA251_14930
    M013:
    M013TW_1602
    MRSA252:
    SAR1665
    MSHR1132:
    SAMSHR1132_14270
    MSSA476:
    SAS1525
    Mu3:
    SAHV_1575
    Mu50:
    SAV1588
    MW2:
    MW1539
    RF122:
    SAB1460c
    ST398:
    SAPIG1653
    T0131:
    SAT0131_01683
    TCH60:
    HMPREF0772_11553 (comEC)
    TW20:
    SATW20_15830
    USA300_TCH1516:
    USA300HOU_1589 (comEC)
    VC40:
    SAVC_07195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------MLSTFLFILLLYITYRKNKIVYAPISLFLIIFSAWYLHYSQQ
    N315            MLYVALSMIVGVLWNSSKVLSTFLFILLLYITYRKNKIVYAPISLFLIIFSSWYLHYSQQ
    NCTC8325        ------------------MLSTFLFILLLYITYRKNKIVYAPISLFLIIFSAWYLHYSQQ
    Newman          MLFVALSMIVGVLWNSSKVLSTFLFILLLYITYRKNKIVYAPISLFLIIFSAWYLHYSQQ
    USA300_FPR3757  MLFVALSMIVGVLWNSSKVLSTFLFILLLYITYRKNKIVYAPISLFLIIFSAWYLHYSQQ
                                      :********************************:********

    COL             AIFNYINYIERNSQFNERAQVIQIQRQGSDTYKGRLSLKNEIYPFFLTDKKNFDLKKIES
    N315            AIFNYINYIERNSQFNERAQVIQIQRQGSDTYKGRLSLKNEIYPFFLTDKKNFDLKKIES
    NCTC8325        AIFNYINYIERNSQFNERAQVIQIQRQGSDTYKGRLSLKNEIYPFFLTDKKNFDLKKIES
    Newman          AIFNYINYIERNSQFNERAQVIQIQRQGSDTYKGRLSLKNEIYPFFLTDKKNFDLKKIES
    USA300_FPR3757  AIFNYINYIERNSQFNERAQVIQIQRQGSDTYKGRLSLKNEIYPFFLTDKKNFDLKKIES
                    ************************************************************

    COL             RNCIVKGQFKVNDNKFVTLKLQSIVVQSCLESNRSNLIEKHKQFIMNRIYDSGIKFPDRI
    N315            RNCIVKGQFKVNENKFVTLKLQSIVVQSCLESNRSNLIEKHKQFIMNRIYDSGIKFPDRI
    NCTC8325        RNCIVKGQFKVNDNKFVTLKLQSIVVQSCLESNRSNLIEKHKQFIMNRIYDSGIKFPDRI
    Newman          RNCIVKGQFKVNDNKFVTLKLQSIVVQSCLESNRSNLIEKHKQFIMNRIYDSGIKFPDRI
    USA300_FPR3757  RNCIVKGQFKVNDNKFVTLKLQSIVVQSCLESNRSNLIEKHKQFIMNRIYDSGIKFPDRI
                    ************:***********************************************

    COL             MALITGDVKEVNEQFKERVKEIGIYHLLAVSGSHIAAIVFLIYQPLKRLNLPLFVIKGIT
    N315            MALITGDVKEINEQFKERVKEIGIYHLLAVSGSHIAAIVFLIYQPLKRLNLPLFVIKGIT
    NCTC8325        MALITGDVKEVNEQFKERVKEIGIYHLLAVSGSHIAAIVFLIYQPLKRLNLPLFVIKGIT
    Newman          MALITGDVKEVNEQFKERVKEIGIYHLLAVSGSHIAAIVFLIYQPLKRLNLPLFVIKGIT
    USA300_FPR3757  MALITGDVKEVNEQFKERVKEIVIYHLLAVSGSHIAAIVFLIYQPLKRLNLPLFVIKGIT
                    **********:*********** *************************************

    COL             IIVLALFAQYTNYAPSAVRAIIMTTLVLVITKQIKIKSIQLLAFAFIIMFILNPLVVYDI
    N315            IIVLTLYAQYTNYAPSAVRAIIMTTLVLLITKQIKIKGIQLLAFAFIIMFILNPLVVYDI
    NCTC8325        IIVLALFAQYTNYAPSAVRAIIMTTLVLVITKQIKIKGIQLLAFAFIIMFILNPLVVYDI
    Newman          IIVLALFAQYTNYAPSAVRAIIMTTLVLVITKQIKIKSIQLLAFAFIIMFILNPLVVYDI
    USA300_FPR3757  IIVLALFAQYTNYAPSAVRAIIMTTLVLVITKQIKIKSIQLLAFAFIIMFILNPLVVYDI
                    ****:*:*********************:********.**********************

    COL             GFQFSFIISFFIMLLFPFLQQLSKLQSLFIITFIAQLASFIVAIPSFHQLQWVGFLSNLI
    N315            GFQFSFIISFFIMLLFPFLQQLSKLQSLFIITFIAQLASFIVAIPNFHQLQWVGFLSNLI
    NCTC8325        GFQFSFIISFFIMLLFPFLQQLSKLQSLFIITFIAQLASFIVAIPSFHQLQWVGFLSNLI
    Newman          GFQFSFIISFFIMLLFPFLQQLSKLQSLFIITFIAQLASFIVAIPSFHQLQWVGFLSNLI
    USA300_FPR3757  GFQFSFIISFFIMLLFPFLQQLSKLQSLFIITFIAQLASFIVAIPSFHQLQWVGFLSNLI
                    *********************************************.**************

    COL             FVPYYSIILFPLSILFFITSHFIVGLTPLNYLVDLSFNFHDWLLDLFTRIKQSHFSVPKF
    N315            FVPYYSIILFPLSILFFITSHFIVGLTPLNYLVDLSFNFHDWLLDLFTRIKQSHFSVPKF
    NCTC8325        FVPYYSIILFPLSILFFITSHFIVGLTPLNYLVDLSFNFHDWLLDLFTRIKQSHFSVPKF
    Newman          FVPYYSIILFPLSILFFITSHFIVGLTPLNYLVDLSFNFHDWLLDLFTRIKQSHFSVPKF
    USA300_FPR3757  FVPYYSIILFPLSILFFITSHFIVGLTPLNYLVDLSFNFHDWLLDLFTRIKQSHFSVPKF
                    ************************************************************

    COL             NDWIFIVFIISVYYIFWLLAKRKYILVTFWTIIILTLLITFPTNSHHKITMLNVGQGDSI
    N315            NDWIFIIFIISVYYIFWLLAKRKYILVTFWTIIILTLLITFPTNSHHKITMLNVGQGDSI
    NCTC8325        NDWIFIVFIISVYYIFWLLAKRKYILVTFWTIIILTLLITFPTNSHHKITMLNVGQGDSI
    Newman          NDWIFIVFIISVYYIFWLLAKRKYILVTFWTIIILTLLITFPTNSHHKITMLNVGQGDSI
    USA300_FPR3757  NDWIFIVFIISVYYIFWLLAKRKYILVTFWTIIILTLLITFPTNSHHKITMLNVGQGDSI
                    ******:*****************************************************

    COL             LYEGGKNQNVLIDTGGKVIDDTKQPSYSISKYHILPTLNERGINELEYLILTHPHNDHIG
    N315            LYEGGKNQNVLIDTGGKVIDDTKQPSYSISKYHILPTLNERGINELEYLILTHPHNDHIG
    NCTC8325        LYEGGKNQNVLIDTGGKVIDDTKQPSYSISKYHILPTLNERGINELEYLILTHPHNDHIG
    Newman          LYEGGKNQNVLIDTGGKVIDDTKQPSYSISKYHILPTLNERGINELEYLILTHPHNDHIG
    USA300_FPR3757  LYEGGKNQNVLIDTGGKVIDDTKQPSYSISKYHILPTLNERGINELEYLILTHPHNDHIG
                    ************************************************************

    COL             EVEYIISHIKIKHIVIYNKGYSSNTLMLLSKLSHKYNIKLMDVRQVSSFKLGDSSFLFFD
    N315            EVEYIISHIKIKHIVIYNKGYSSNTLMLLSKLSHKYNIKLMDVRQVSSFKLGDSSFLFFD
    NCTC8325        EVEYIISHIKIKHIVIYNKGYSSNTLMLLSKLSHKYNIKLMDVRQVSSFKLGDSSFLFFD
    Newman          EVEYIISHIKIKHIVIYNKGYSSNTLMLLSKLSHKYNIKLMDVRQVSSFKLGDSSFLFFD
    USA300_FPR3757  EVEYIISHIKIKHIVIYNKGYSSNTLMLLSKLSHKYNIKLMDVRQVSSFKLGDSSFLFFD
                    ************************************************************

    COL             SFIPNSRDKNEYSIITMITYQNKKVLLMGDASKNNESLLLKKYNLPEIDILKVGHHGSKT
    N315            SFIPNSRDKNEYSIITMITYQNKKVLLMGDASKNNESLLLKKYNLPEIDILKVGHHGSKT
    NCTC8325        SFIPNSRDKNEYSIITMITYQNKKVLLMGDASKNNESLLLKKYNLPEIDILKVGHHGSKT
    Newman          SFIPNSRDKNEYSIITMITYQNKKVLLMGDASKNNESLLLKKYNLPEIDILKVGHHGSKT
    USA300_FPR3757  SFIPNSRDKNEYSIITMITYQNKKVLLMGDASKNNESLLLKKYNLPEIDILKVGHHGSKT
                    ************************************************************

    COL             SSSKEFIEMIKPKISLISSGKNNMYHLPNIEVVKRLQRIRSRIYNSQQNGQVTIDLDDNL
    N315            SSSKEFIEMIKPKISLISSGKNNMYHLPNIEVVKRLQRIRSRIYNSQQNGQVTIDLDDNL
    NCTC8325        SSSKEFIEMIKPKISLISSGKNNMYHLPNIEVVKRLQRIRSRIYNSQQNGQVTIDLDDNL
    Newman          SSSKEFIEMIKPKISLISSGKNNMYHLPNIEVVKRLQRIRSRIYNSQQNGQVTIDLDDNL
    USA300_FPR3757  SSSKEFIEMIKPKISLISSGKNNMYHLPNIEVVKRLQRIRSRIYNSQQNGQVTIDLDDNL
                    ************************************************************

    COL             KVDSSSYGNASGL
    N315            KVDSNSYGNASGL
    NCTC8325        KVDSSSYGNASGL
    Newman          KVDSSSYGNASGL
    USA300_FPR3757  KVDSSSYGNASGL
                    ****.********