From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004175000
  • symbol?: comEB
  • description?: late competence operon required for DNA binding and uptake comEB

      descriptions from strain specific annotations:

    • late competence operon required for DNA binding and uptake comEB
    • comE operon protein 2
    • deaminase
    • late competence deaminase protein
    • competence protein ComEB required for DNA binding and uptake
    • putative deaminase
    • dCMP deaminase
    • Late competence protein ComEB
    • deoxycytidylate deaminase ComEB
    • dCMP deaminase, Late competence protein ComEB
    • ComE operon protein ComEB
  • strand?: -
  • coordinates?: 4440042..4440473
  • synteny block?: BlockID0032050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1417 (comEB)
    NCTC8325:
    Newman:
    NWMN_1491 (comEB)
    USA300_FPR3757:
    04-02981:
    SA2981_1547 (comEB)
    08BA02176:
    C248_1631
    11819-97:
    MS7_1606
    71193:
    ST398NM01_1654
    ECT-R 2:
    ECTR2_1438
    ED133:
    SAOV_1588
    ED98:
    SAAV_1580
    HO 5096 0412:
    SAEMRSA15_15080
    JH1:
    SaurJH1_1681
    JH9:
    SaurJH9_1646
    JKD6008:
    SAA6008_01559 (comEB)
    JKD6159:
    SAA6159_01524 (comEB)
    LGA251:
    SARLGA251_14940
    M013:
    M013TW_1603
    MRSA252:
    SAR1666
    MSHR1132:
    SAMSHR1132_14280
    MSSA476:
    SAS1526
    Mu3:
    SAHV_1576 (comEB)
    Mu50:
    SAV1589 (comEB)
    MW2:
    MW1540 (comEB)
    RF122:
    SAB1461c
    ST398:
    SAPIG1654
    T0131:
    SAT0131_01684
    TCH60:
    HMPREF0772_11552 (comEB)
    TW20:
    SATW20_15840
    USA300_TCH1516:
    USA300HOU_1590 (comEB)
    VC40:
    SAVC_07200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------MAQSHLLALRSTCQRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLI
    N315            MERIKWEEYFMAQSHLLALRSTCQRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLI
    NCTC8325        ----------MAQSHLLALRSTCQRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLI
    Newman          MERIKWEEYFMAQSHLLALRSTCQRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLI
    USA300_FPR3757  ----------MAQSHLLALRSTCQRLSVGATIVKDNRIIAGGYNGSVAGEVHCIDEGCLI
                              **************************************************

    COL             EDGHCIRTIHAEMNALLQCAKQGVSTEGATIYVTHFPCLNCTKSIIQAGIKRIYYAEDYH
    N315            EDGHCIRTIHAEMNALLQCAKQGVSTEGATIYVTHFPCLNCTKSIIQAGIKRIYYAEDYH
    NCTC8325        EDGHCIRTIHAEMNALLQCAKQGVSTEGATIYVTHFPCLNCTKSIIQAGIKRIYYAEDYH
    Newman          EDGHCIRTIHAEMNALLQCAKQGVSTEGATIYVTHFPCLNCTKSIIQAGIKRIYYAEDYH
    USA300_FPR3757  EDGHCIRTIHAEMNALLQCAKQGVSTEGATIYVTHFPCLNCTKSIIQAGIKRIYYAEDYH
                    ************************************************************

    COL             NHEYATKLLKQSGIEFKKIPFSPEYVAKYLTKG
    N315            NHEYATKLLKQSGIEFKKIPFSPEYVAKYLTKG
    NCTC8325        NHEYATKLLKQSGIEFKKIPFSPEYVAKYLTKG
    Newman          NHEYATKLLKQSGIEFKKIPFSPEYVAKYLTKG
    USA300_FPR3757  NHEYATKLLKQSGIEFKKIPFSPEYVAKYLTKG
                    *********************************