From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004176000
  • symbol?: comEA
  • description?: competence protein ComEA

      descriptions from strain specific annotations:

    • competence protein ComEA
    • comE operon protein 1-related protein
    • Late competence protein ComEA, DNA receptor
    • competence protein ComEA helix-hairpin-helix repeat region domain protein
    • competence ComEA helix-hairpin-helix repeat region domain protein
    • comE operon protein 1-like protein
    • ComE operon protein 1
    • competence-related membrane protein
  • strand?: -
  • coordinates?: 4440595..4441302
  • synteny block?: BlockID0032060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1646 (comEA)
    N315:
    NCTC8325:
    Newman:
    NWMN_1492 (comEA)
    USA300_FPR3757:
    04-02981:
    SA2981_1548 (comEA)
    08BA02176:
    C248_1632
    11819-97:
    MS7_1607
    71193:
    ST398NM01_1655
    ECT-R 2:
    ECTR2_1439
    ED133:
    SAOV_1589
    ED98:
    SAAV_1581 (comEA)
    HO 5096 0412:
    SAEMRSA15_15090
    JH1:
    SaurJH1_1682
    JH9:
    SaurJH9_1647
    JKD6008:
    SAA6008_01560 (comEA)
    JKD6159:
    SAA6159_01525 (comEA)
    LGA251:
    SARLGA251_14950
    M013:
    M013TW_1604
    MRSA252:
    SAR1667
    MSHR1132:
    SAMSHR1132_14290
    MSSA476:
    SAS1527
    Mu3:
    SAHV_1577
    Mu50:
    SAV1590
    MW2:
    MW1541
    RF122:
    SAB1462c
    ST398:
    SAPIG1655
    T0131:
    SAT0131_01685 (radA)
    TCH60:
    HMPREF0772_11551 (comEA)
    TW20:
    SATW20_15850
    USA300_TCH1516:
    USA300HOU_1591 (comEA)
    VC40:
    SAVC_07205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVLLYQFLLRYKDFLTQWKLYILSAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTS
    N315            ---MYQFLLRYKDFLTQWKLYIISAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTS
    NCTC8325        MVLLYQFLLRYKDFLTQWKLYILSAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTS
    Newman          ---MYQFLLRYKDFLTQWKLYILSAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTS
    USA300_FPR3757  MVLLYQFLLRYKDFLTQWKLYILSAVVLIMVLIGFIFWRQDDYTSRNFENKDTALKQSTS
                       :******************:*************************************

    COL             ENSSLSKVEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLEDA
    N315            ENNSLSKLEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLDDA
    NCTC8325        ENSSLSKVEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLEDA
    Newman          ENSSLSKVEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLEDA
    USA300_FPR3757  ENSSLSKVEDVQVKDGDNSKNKGPVYVDVKGAVKHPNVYKMTSKDRVVDLLDKAQLLEDA
                    **.****:*************************************************:**

    COL             DVSQINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHEKNGNTNNTKVNLNTASVSELMS
    N315            DVSRINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHVKNGNTNNTKVNLNTASVSELMS
    NCTC8325        DVSQINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHEKNGNTNNTKVNLNTASVSELMS
    Newman          DVSQINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHEKNGNTNNTKVNLNTASVSELMS
    USA300_FPR3757  DVSQINLSEKLTDQKMIFIPHKGQKNVEPQIEVNSVHEKNGNTNNTKVNLNTASVSELMS
                    ***:********************************* **********************

    COL             VPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTT
    N315            VPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTI
    NCTC8325        VPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTT
    Newman          VPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTT
    USA300_FPR3757  VPGVGQAKANAIVEYRNQQGAFQEIDDLKKVKGFGSKTFDKLKSYFTT
                    ***********************************************