From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004183000
  • symbol?:
  • description?: GTP-binding protein YqeH

      descriptions from strain specific annotations:

    • GTP-binding protein YqeH
    • ribosome biogenesis GTPase YqeH
    • GTPase
    • GTPase family protein
    • GTPase YqeH
    • GTP-binding protein YqeH, possibly involved in replication initiation
    • putative GTPase
  • strand?: -
  • coordinates?: 4444686..4445786
  • synteny block?: BlockID0032130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1555 (yqeH)
    08BA02176:
    C248_1639
    11819-97:
    MS7_1614 (yqeH)
    71193:
    ST398NM01_1662
    ECT-R 2:
    ECTR2_1446
    ED133:
    SAOV_1596
    ED98:
    SAAV_1588
    HO 5096 0412:
    SAEMRSA15_15160
    JH1:
    SaurJH1_1689
    JH9:
    SaurJH9_1654
    JKD6008:
    SAA6008_01567
    JKD6159:
    SAA6159_01532
    LGA251:
    SARLGA251_15020
    M013:
    M013TW_1611
    MRSA252:
    SAR1674
    MSHR1132:
    SAMSHR1132_14360
    MSSA476:
    SAS1534
    Mu3:
    SAHV_1584
    Mu50:
    SAV1597
    MW2:
    MW1548
    RF122:
    SAB1469c
    ST398:
    SAPIG1662
    T0131:
    SAT0131_01693
    TCH60:
    HMPREF0772_11544 (yqeH)
    TW20:
    SATW20_15930
    USA300_TCH1516:
    USA300HOU_1598
    VC40:
    SAVC_07240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDILKCIGCGAPLQSEDKNKPGFVPEHNMFRDDVICRRCFRLKNYNEVQDVGLESEDFL
    N315            MSDILKCIGCGAPLQSEDKNKPGFVPEHNMFRDDVICRRCFRLKNYNEVQDVGLESEDFL
    NCTC8325        MSDILKCIGCGAPLQSEDKNKPGFVPEHNMFRDDVICRRCFRLKNYNEVQDVGLESEDFL
    Newman          MSDILKCIGCGAPLQSEDKNKPGFVPEHNMFRDDVICRRCFRLKNYNEVQDVGLESEDFL
    USA300_FPR3757  MSDILKCIGCGAPLQSEDKNKPGFVPEHNMFRDDVICRRCFRLKNYNEVQDVGLESEDFL
                    ************************************************************

    COL             KLLSGLADKKGIVVNVVDVFDFEGSFINAVKRIVGNKKIILAANKLDLLPKQINKRRVKE
    N315            KLLSGLADKKGIVVNVVDVFDFEGSFINAVKRIVGNKKIILAANKLDLLPKQINKRRVKE
    NCTC8325        KLLSGLADKKGIVVNVVDVFDFEGSFINAVKRIVGNKKIILAANKLDLLPKQINKRRVKE
    Newman          KLLSGLADKKGIVVNVVDVFDFEGSFINAVKRIVGNKKIILAANKLDLLPKQINKRRVKE
    USA300_FPR3757  KLLSGLADKKGIVVNVVDVFDFEGSFINAVKRIVGNKKIILAANKLDLLPKQINKRRVKE
                    ************************************************************

    COL             WLKRTARKYGLEADDVVLISAEKGWGIDDLLSSIANIRENEDVYIVGTTNVGKSTLINKL
    N315            WLKRTARKYGLEADDVVLISAEKGWGIDDLLSSIANIRENEDVYIVGTTNVGKSTLINKL
    NCTC8325        WLKRTARKYGLEADDVVLISAEKGWGIDDLLSSIANIRENEDVYIVGTTNVGKSTLINKL
    Newman          WLKRTARKYGLEADDVVLISAEKGWGIDDLLSSIANIRENEDVYIVGTTNVGKSTLINKL
    USA300_FPR3757  WLKRTARKYGLEADDVVLISAEKGWGIDDLLSSIANIRENEDVYIVGTTNVGKSTLINKL
                    ************************************************************

    COL             IEASVGEKDVVTTSRFPGTTLDMIDIPLDETSFMYDTPGIIQDHQMTHLVSEKELKIIMP
    N315            IEASVGEKDVVTTSRFPGTTLDMIDIPLDESSFMYDTPGIIQDHQMTHLVSEKELKIIMP
    NCTC8325        IEASVGEKDVVTTSRFPGTTLDMIDIPLDETSFMYDTPGIIQDHQMTHLVSEKELKIIMP
    Newman          IEASVGEKDVVTTSRFPGTTLDMIDIPLDETSFMYDTPGIIQDHQMTHLVSEKELKIIMP
    USA300_FPR3757  IEASVGEKDVVTTSRFPGTTLDMIDIPLDETSFMYDTPGIIQDHQMTHLVSEKELKIIMP
                    ******************************:*****************************

    COL             KKEIKQRVYQLNEAQTLFFGGLARIDYVSGGKRPLVCFFSNDLNIHRTKTEKANDLWRNQ
    N315            KKEIKQRVYQLNEAQTLFFGGLARIDYVSGGKRPLVCFFSNDLNIHRTKTEKANDLWRNQ
    NCTC8325        KKEIKQRVYQLNEAQTLFFGGLARIDYVSGGKRPLVCFFSNDLNIHRTKTEKANDLWRNQ
    Newman          KKEIKQRVYQLNEAQTLFFGGLARIDYVSGGKRPLVCFFSNDLNIHRTKTEKANDLWRNQ
    USA300_FPR3757  KKEIKQRVYQLNEAQTLFFGGLARIDYVSGGKRPLVCFFSNDLNIHRTKTEKANDLWRNQ
                    ************************************************************

    COL             LGDLLTPPGNPQNFDLNEVKAVRLETGKEKRDVMISGLGFITIGPGAKVIVRVPKNVDVV
    N315            LGDLLTPPGNPQNFDLNELKAVRLETGKEKRDVMISGLGFITIGPGAKVIVRVPKNVDVV
    NCTC8325        LGDLLTPPGNPQNFDLNEVKAVRLETGKEKRDVMISGLGFITIGPGAKVIVRVPKNVDVV
    Newman          LGDLLTPPGNPQNFDLNEVKAVRLETGKEKRDVMISGLGFITIGPGAKVIVRVPKNVDVV
    USA300_FPR3757  LGDLLTPPGNPQNFDLNEVKAVRLETGKEKRDVMISGLGFITIGPGAKVIVRVPKNVDVV
                    ******************:*****************************************

    COL             LRNSIL
    N315            LRNSIL
    NCTC8325        LRNSIL
    Newman          LRNSIL
    USA300_FPR3757  LRNSIL
                    ******