From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004212000
  • symbol?:
  • description?: Holliday junction resolvase-like protein

      descriptions from strain specific annotations:

    • Holliday junction resolvase-like protein
    • Putative Holliday junction resolvase
    • crossover junction endodeoxyribonuclease
    • endonuclease
  • strand?: -
  • coordinates?: 4463989..4464216
  • synteny block?: BlockID0032400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1574
    08BA02176:
    C248_1658
    11819-97:
    MS7_1632 (yrrK)
    71193:
    ST398NM01_1680
    ECT-R 2:
    ECTR2_1465
    ED133:
    SAOV_1614
    ED98:
    SAAV_1608
    HO 5096 0412:
    SAEMRSA15_15340
    JH1:
    SaurJH1_1707
    JH9:
    SaurJH9_1673
    JKD6008:
    SAA6008_01586
    JKD6159:
    SAA6159_01549
    LGA251:
    SARLGA251_15190
    M013:
    M013TW_1635
    MRSA252:
    SAR1695
    MSHR1132:
    SAMSHR1132_14530
    MSSA476:
    SAS1552
    Mu3:
    SAHV_1603
    Mu50:
    SAV1616
    MW2:
    MW1566
    RF122:
    SAB1487c
    ST398:
    SAPIG1680
    T0131:
    SAT0131_01713
    TCH60:
    HMPREF0772_11525
    TW20:
    SATW20_16110
    USA300_TCH1516:
    USA300HOU_1616
    VC40:
    SAVC_07330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLQHKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTV
    N315            -------------------MSDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTV
    NCTC8325        MLQHKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTV
    Newman          MLQHKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTV
    USA300_FPR3757  MLQHKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTV
                                       :****************************************

    COL             VIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQK
    N315            VIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQK
    NCTC8325        VIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQK
    Newman          VIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQK
    USA300_FPR3757  VIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQK
                    ************************************************************

    COL             RKQVIDKMAAVFILQGYLDSLH
    N315            RKQVIDKMAAVFILQGYLDSLH
    NCTC8325        RKQVIDKMAAVFILQGYLDSLH
    Newman          RKQVIDKMAAVFILQGYLDSLH
    USA300_FPR3757  RKQVIDKMAAVFILQGYLDSLH
                    **********************