From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004228000
  • symbol?: cymR
  • description?: Rrf2 family transcriptional regulator

      descriptions from strain specific annotations:

    • Rrf2 family transcriptional regulator
    • Rrf2 family protein
    • BadM/Rrf2 family transcriptional regulator
    • HTH-type transcriptional regulator CymR
    • Iron-sulfur cluster regulator IscR
    • Rfr2 family transcriptional regulator
    • rrf2 family protein (transcriptional regulator) family protein
  • strand?: -
  • coordinates?: 4476189..4476612
  • synteny block?: BlockID0032560
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1584 (iscR)
    08BA02176:
    C248_1668
    11819-97:
    MS7_1642 (cymR)
    71193:
    ST398NM01_1690
    ECT-R 2:
    ECTR2_1475
    ED133:
    SAOV_1624
    ED98:
    SAAV_1619
    HO 5096 0412:
    SAEMRSA15_15440
    JH1:
    SaurJH1_1717
    JH9:
    SaurJH9_1684
    JKD6008:
    SAA6008_01596
    JKD6159:
    SAA6159_01559
    LGA251:
    SARLGA251_15290
    M013:
    M013TW_1647
    MRSA252:
    SAR1706
    MSHR1132:
    SAMSHR1132_14630
    MSSA476:
    SAS1562
    Mu3:
    SAHV_1613
    Mu50:
    SAV1626
    MW2:
    MW1576
    RF122:
    SAB1496c
    ST398:
    SAPIG1690
    T0131:
    SAT0131_01723
    TCH60:
    HMPREF0772_11515
    TW20:
    SATW20_16210
    USA300_TCH1516:
    VC40:
    SAVC_07380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRG
    N315            MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRG
    NCTC8325        MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRG
    Newman          MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRG
    USA300_FPR3757  MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRG
                    ************************************************************

    COL             AKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTL
    N315            AKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTL
    NCTC8325        AKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTL
    Newman          AKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTL
    USA300_FPR3757  AKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTL
                    ************************************************************

    COL             KYLAEYVDTSEDLDGYMFYI
    N315            KYLAEYVDTSEDLDGYMFYI
    NCTC8325        KYLAEYVDTSEDLDGYMFYI
    Newman          KYLAEYVDTSEDLDGYMFYI
    USA300_FPR3757  KYLAEYVDTSEDLDGYMFYI
                    ********************