From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004243000
  • symbol?: secDF
  • description?: preprotein translocase subunit SecD/SecF

      descriptions from strain specific annotations:

    • preprotein translocase subunit SecD/SecF
    • bifunctional preprotein translocase subunit SecD/SecF
    • Protein-export membrane protein secD / Protein-export membrane protein secF
    • protein-export membrane protein SecD
    • protein translocase subunit SecDF
    • putative protein-export membrane protein
    • RND superfamily resistance-nodulation-cell division protein:proton (H+) antiporter
    • Protein translocase subunit secF / protein translocase subunit secD
    • protein-export membrane protein SecDF
    • protein-export membrane protein SecD/SecF
  • strand?: -
  • coordinates?: 4489907..4492126
  • synteny block?: BlockID0032710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1463 (secF)
    NCTC8325:
    Newman:
    NWMN_1539 (secDF)
    USA300_FPR3757:
    04-02981:
    SA2981_1595 (secD)
    08BA02176:
    C248_1680 (secF)
    11819-97:
    MS7_1652 (secDF)
    71193:
    ST398NM01_1700
    ECT-R 2:
    ECTR2_1485 (secD)
    ED133:
    SAOV_1634 (secF)
    ED98:
    SAAV_1630
    HO 5096 0412:
    SAEMRSA15_15540 (secF)
    JH1:
    SaurJH1_1727
    JH9:
    SaurJH9_1694
    JKD6008:
    SAA6008_01606 (secF)
    JKD6159:
    SAA6159_01569 (secF)
    LGA251:
    SARLGA251_15390 (secF)
    M013:
    M013TW_1657
    MRSA252:
    SAR1717 (secF)
    MSHR1132:
    SAMSHR1132_14730
    MSSA476:
    SAS1573
    Mu3:
    SAHV_1624 (secF)
    Mu50:
    SAV1637 (secF)
    MW2:
    MW1587 (secF)
    RF122:
    SAB1506c (secF)
    ST398:
    SAPIG1700
    T0131:
    SAT0131_01737
    TCH60:
    HMPREF0772_11505 (secDF)
    TW20:
    SATW20_16310 (secF)
    USA300_TCH1516:
    USA300HOU_1636 (secDF)
    VC40:
    SAVC_07430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKSSRIIAFLLLVVLLFAGMAATYKSVIKNVNLGLDLQGGFEVLYQVDPLNKGDKIDKK
    N315            MKKSSRIIAFLLLVVLLFAGMAATYKSVIKNVNLGLDLQGGFEVLYQVDPLNKGDKIDKK
    NCTC8325        MKKSSRIIAFLLLVVLLFAGMAATYKSVIKNVNLGLDLQGGFEVLYQVDPLNKGDKIDKK
    Newman          MKKSSRIIAFLLLVVLLFAGMAATYKSVIKNVNLGLDLQGGFEVLYQVDPLNKGDKIDKK
    USA300_FPR3757  MKKSSRIIAFLLLVVLLFAGMAATYKSVIKNVNLGLDLQGGFEVLYQVDPLNKGDKIDKK
                    ************************************************************

    COL             ALQSTAQTLENRVNVLGVSEPKIQVEEPNRIRVQLAGVTDQNEARKILSSQANLTIRDAE
    N315            ALQSTAQTLENRVNVLGVSEPKIQVEEPNRIRVQLAGVTDQNEARKILSSQANLTIRDAE
    NCTC8325        ALQSTAQTLENRVNVLGVSEPKIQVEEPNRIRVQLAGVTDQNEARKILSSQANLTIRDAE
    Newman          ALQSTAQTLENRVNVLGVSEPKIQVEEPNRIRVQLAGVTDQNEARKILSSQANLTIRDAE
    USA300_FPR3757  ALQSTAQTLENRVNVLGVSEPKIQVEEPNRIRVQLAGVTDQNEARKILSSQANLTIRDAE
                    ************************************************************

    COL             DKVKLSGSDIKQGSAKQEFKQETNQPTVTFKVKDKNKFKKVTEEISKKRDNVMVVWLDFK
    N315            DKVKLSGSDIKQGSAKQEFKQETNQPTVTFKVKDKNKFKKVTEEISKKRDNVMVVWLDFK
    NCTC8325        DKVKLSGSDIKQGSAKQEFKQETNQPTVTFKVKDKNKFKKVTEEISKKRDNVMVVWLDFK
    Newman          DKVKLSGSDIKQGSAKQEFKQETNQPTVTFKVKDKNKFKKVTEEISKKRDNVMVVWLDFK
    USA300_FPR3757  DKVKLSGSDIKQGSAKQEFKQETNQPTVTFKVKDKNKFKKVTEEISKKRDNVMVVWLDFK
                    ************************************************************

    COL             KGDSYKKEAQKKNPKFISAASVDQPINSDSVEISGGFKGQEGVKKAKQIAELLNAGSLPV
    N315            KGDSYKKEAQKKNPKFISAASVDQPINSDSVEISGGFKGQEGVKKAKQIAELLNAGSLPV
    NCTC8325        KGDSYKKEAQKKNPKFISAASVDQPINSDSVEISGGFKGQEGVKKAKQIAELLNAGSLPV
    Newman          KGDSYKKEAQKKNPKFISAASVDQPINSDSVEISGGFKGQEGVKKAKQIAELLNAGSLPV
    USA300_FPR3757  KGDSYKKEAQKKNPKFISAASVDQPINSDSVEISGGFKGQEGVKKAKQIAELLNAGSLPV
                    ************************************************************

    COL             DLKEIYSNSVGAQFGQDALDKTVFASFIGVALIYLFMLGFYRLPGLVAIIALTTYIYLTL
    N315            DLKEIYSNSVGAQFGQDALDKTVFASFIGVALIYLFMLGFYRLPGLVAIIALTTYIYLTL
    NCTC8325        DLKEIYSNSVGAQFGQDALDKTVFASFIGVALIYLFMLGFYRLPGLVAIIALTTYIYLTL
    Newman          DLKEIYSNSVGAQFGQDALDKTVFASFIGVALIYLFMLGFYRLPGLVAIIALTTYIYLTL
    USA300_FPR3757  DLKEIYSNSVGAQFGQDALDKTVFASFIGVALIYLFMLGFYRLPGLVAIIALTTYIYLTL
                    ************************************************************

    COL             VAFNFISGVLTLPGLAALVLGVGMAVDANIIMYERIKDELRIGRTIKQAFSKANKSSFLT
    N315            VAFNFISGVLTLPGLAALVLGVGMAVDANIIMYERIKDELRIGRTIKQAFSKANKSSFLT
    NCTC8325        VAFNFISGVLTLPGLAALVLGVGMAVDANIIMYERIKDELRIGRTIKQAFSKANKSSFLT
    Newman          VAFNFISGVLTLPGLAALVLGVGMAVDANIIMYERIKDELRIGRTIKQAFSKANKSSFLT
    USA300_FPR3757  VAFNFISGVLTLPGLAALVLGVGMAVDANIIMYERIKDELRIGRTIKQAFSKANKSSFLT
                    ************************************************************

    COL             IFDSNLTTVIAAAVLFFFGESSVKGFATMLLLGILMIFVTAVFLSRFLLSLLVSSNIFKN
    N315            IFDSNLTTVIAAAVLFFFGESSVKGFATMLLLGILMIFVTAVFLSRFLLSLLVSSNIFKN
    NCTC8325        IFDSNLTTVIAAAVLFFFGESSVKGFATMLLLGILMIFVTAVFLSRFLLSLLVSSNIFKN
    Newman          IFDSNLTTVIAAAVLFFFGESSVKGFATMLLLGILMIFVTAVFLSRFLLSLLVSSNIFKN
    USA300_FPR3757  IFDSNLTTVIAAAVLFFFGESSVKGFATMLLLGILMIFVTAVFLSRFLLSLLVSSNIFKN
                    ************************************************************

    COL             QFWLFGVKKNKRHDINEGVDVHDLKTSFEKWNFVKLAKPLIGVSILIVVVGLVILYIFKL
    N315            QFWLFGVKKNKRHDINEGVDVHDLKTSFEKWNFVKLAKPLIGVSILIVVVGLVILYIFKL
    NCTC8325        QFWLFGVKKNKRHDINEGVDVHDLKTSFEKWNFVKLAKPLIGVSILIVVVGLVILYIFKL
    Newman          QFWLFGVKKNKRHDINEGVDVHDLKTSFEKWNFVKLAKPLIGVSILIVVVGLVILYIFKL
    USA300_FPR3757  QFWLFGVKKNKRHDINEGVDVHDLKTSFEKWNFVKLAKPLIGVSILIVVVGLVILYIFKL
                    ************************************************************

    COL             NLGIDFSSGTRVDFQSKQAITQQKVEQVVKDSGLKADQIQINGKDNKVATVQFKDDLTRA
    N315            NLGIDFSSGTRVDFQSKQAITQQKVEQVVKDSGLKADQIQINGKDNKVATVQFKDDLTRA
    NCTC8325        NLGIDFSSGTRVDFQSKQAITQQKVEQVVKDSGLKADQIQINGKDNKVATVQFKDDLTRA
    Newman          NLGIDFSSGTRVDFQSKQAITQQKVEQVVKDSGLKADQIQINGKDNKVATVQFKDDLTRA
    USA300_FPR3757  NLGIDFSSGTRVDFQSKQAITQQKVEQVVKDSGLKADQIQINGKDNKVATVQFKDDLTRA
                    ************************************************************

    COL             QDNKLSDNIKSKFGDTPQINTVSPIIGQELAKNAMLALIYASIGIIIYVSLRFEWRMGLS
    N315            QDNKLSDNIKSKFGDTPQINTVSPIIGQELAKNAMLALIYASIGIIIYVSLRFEWRMGLS
    NCTC8325        QDNKLSDNIKSKFGDTPQINTVSPIIGQELAKNAMLALIYASIGIIIYVSLRFEWRMGLS
    Newman          QDNKLSDNIKSKFGDTPQINTVSPIIGQELAKNAMLALIYASIGIIIYVSLRFEWRMGLS
    USA300_FPR3757  QDNKLSDNIKSKFGDTPQINTVSPIIGQELAKNAMLALIYASIGIIIYVSLRFEWRMGLS
                    ************************************************************

    COL             SVLALLHDVFIIVAIFSLFRIEVDLTFIAAVLTIVGYSINDTIVTFDRVRENLQKVKVIT
    N315            SVLALLHDVFIIVAIFSLFRIEVDLTFIAAVLTIVGYSINDTIVTFDRVRENLQKVKVIT
    NCTC8325        SVLALLHDVFIIVAIFSLFRIEVDLTFIAAVLTIVGYSINDTIVTFDRVRENLQKVKVIT
    Newman          SVLALLHDVFIIVAIFSLFRIEVDLTFIAAVLTIVGYSINDTIVTFDRVRENLQKVKVIT
    USA300_FPR3757  SVLALLHDVFIIVAIFSLFRIEVDLTFIAAVLTIVGYSINDTIVTFDRVRENLQKVKVIT
                    ************************************************************

    COL             TTEQIDDIVNRSIRQTMTRSINTVLTVIVVVVAILFFGAPTIFNFTLALFIGLISGVFSS
    N315            TTEQIDDIVNRSIRQTMTRSINTVLTVIVVVVAILFFGAPTIFNFTLALFIGLISGVFSS
    NCTC8325        TTEQIDDIVNRSIRQTMTRSINTVLTVIVVVVAILFFGAPTIFNFTLALFIGLISGVFSS
    Newman          TTEQIDDIVNRSIRQTMTRSINTVLTVIVVVVAILFFGAPTIFNFTLALFIGLISGVFSS
    USA300_FPR3757  TTEQIDDIVNRSIRQTMTRSINTVLTVIVVVVAILFFGAPTIFNFTLALFIGLISGVFSS
                    ************************************************************

    COL             IFIAVPLWGIMKKRQLKKSPKHKLVVYKEKKSNDEKILV
    N315            IFIAVPLWGIMKKRQLKKSPKHKLVVYKEKKSNDEKILV
    NCTC8325        IFIAVPLWGIMKKRQLKKSPKHKLVVYKEKKSNDEKILV
    Newman          IFIAVPLWGIMKKRQLKKSPKHKLVVYKEKKSNDEKILV
    USA300_FPR3757  IFIAVPLWGIMKKRQLKKSPKHKLVVYKEKKSNDEKILV
                    ***************************************