From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004247000
  • symbol?: ruvB
  • description?: Holliday junction DNA helicase RuvB

      descriptions from strain specific annotations:

    • Holliday junction DNA helicase RuvB
    • Holliday junction ATP-dependent DNA helicase RuvB
    • crossover junction endodeoxyribonuclease
    • Holliday junction DNA helicase subunit RuvB
    • crossover junction ATP-dependent DNA helicase RuvB
  • strand?: -
  • coordinates?: 4494930..4495934
  • synteny block?: BlockID0032750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1696 (ruvB)
    N315:
    SA1467 (ruvB)
    NCTC8325:
    Newman:
    NWMN_1543 (ruvB)
    USA300_FPR3757:
    04-02981:
    SA2981_1599 (ruvB)
    08BA02176:
    C248_1684 (ruvB)
    11819-97:
    MS7_1656 (ruvB)
    71193:
    ST398NM01_1704
    ECT-R 2:
    ECTR2_1489 (ruvB)
    ED133:
    SAOV_1638 (ruvB)
    ED98:
    SAAV_1634 (ruvB)
    HO 5096 0412:
    SAEMRSA15_15580 (ruvB)
    JH1:
    SaurJH1_1731 (ruvB)
    JH9:
    SaurJH9_1698 (ruvB)
    JKD6008:
    SAA6008_01610 (ruvB)
    JKD6159:
    SAA6159_01573 (ruvB)
    LGA251:
    SARLGA251_15430 (ruvB)
    M013:
    M013TW_1661
    MRSA252:
    SAR1721 (ruvB)
    MSHR1132:
    SAMSHR1132_14770
    MSSA476:
    SAS1577 (ruvB)
    Mu3:
    SAHV_1628 (ruvB)
    Mu50:
    SAV1641 (ruvB)
    MW2:
    MW1591 (ruvB)
    RF122:
    SAB1510c (ruvB)
    ST398:
    SAPIG1704 (ruvB)
    T0131:
    SAT0131_01741
    TCH60:
    HMPREF0772_11501 (ruvB)
    TW20:
    SATW20_16350 (ruvB)
    USA300_TCH1516:
    USA300HOU_1640 (ruvB)
    VC40:
    SAVC_07450 (ruvB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFG
    N315            MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFG
    NCTC8325        MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFG
    Newman          MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFG
    USA300_FPR3757  MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFG
                    ************************************************************

    COL             PPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVV
    N315            PPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVV
    NCTC8325        PPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVV
    Newman          PPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVV
    USA300_FPR3757  PPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVV
                    ************************************************************

    COL             EEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLE
    N315            EEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLE
    NCTC8325        EEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLE
    Newman          EEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLE
    USA300_FPR3757  EEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLE
                    ************************************************************

    COL             YYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQI
    N315            YYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQI
    NCTC8325        YYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQI
    Newman          YYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQI
    USA300_FPR3757  YYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQI
                    ************************************************************

    COL             YIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYE
    N315            YIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYE
    NCTC8325        YIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYE
    Newman          YIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYE
    USA300_FPR3757  YIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYE
                    ************************************************************

    COL             PFLIQKGFLERTPRGRKATPLAYEHFAKSNEERE
    N315            PFLIQKGFLERTPRGRKATPLAYEHFAKSNEERG
    NCTC8325        PFLIQKGFLERTPRGRKATPLAYEHFAKSNEERE
    Newman          PFLIQKGFLERTPRGRKATPLAYEHFAKSNEERE
    USA300_FPR3757  PFLIQKGFLERTPRGRKATPLAYEHFAKSNEERE
                    *********************************