From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004254000
  • symbol?: mreD
  • description?: cell shape determinant mreD

      descriptions from strain specific annotations:

    • cell shape determinant mreD
    • rod shape-determining protein MreD
    • rod shape-determining protein MreD, putative
    • cell shape determining protein MreD
    • membrane protein
  • strand?: -
  • coordinates?: 4501338..4501869
  • synteny block?: BlockID0032820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1550 (mreD)
    USA300_FPR3757:
    04-02981:
    SA2981_1606 (mreD)
    08BA02176:
    C248_1691
    11819-97:
    MS7_1663 (mreD)
    71193:
    ST398NM01_1711
    ECT-R 2:
    ECTR2_1496 (mreD)
    ED133:
    SAOV_1645
    ED98:
    SAAV_1641
    HO 5096 0412:
    SAEMRSA15_15650
    JH1:
    SaurJH1_1738
    JH9:
    SaurJH9_1705
    JKD6008:
    SAA6008_01617 (mreD)
    JKD6159:
    SAA6159_01580 (mreD)
    LGA251:
    SARLGA251_15500
    M013:
    M013TW_1668
    MRSA252:
    SAR1728
    MSHR1132:
    SAMSHR1132_14840
    MSSA476:
    SAS1584
    Mu3:
    SAHV_1635
    Mu50:
    SAV1648
    MW2:
    MW1598
    RF122:
    SAB1517c
    ST398:
    SAPIG1711 (mreD)
    T0131:
    SAT0131_01749 (thiD1)
    TCH60:
    HMPREF0772_11494 (mreD)
    TW20:
    SATW20_16420
    USA300_TCH1516:
    USA300HOU_1647
    VC40:
    SAVC_07485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRTLYYFLIGILLFYIDTAIGLLIPMHIGKFELVFVPHLTFMYILMMVVYRGFGVSLLLS
    N315            MRTLYYFLIGILLFYIDTAIGLLIPMHIGKFELVFVPHLTFMYILMMVVYRGFGVSLLLS
    NCTC8325        MRTLYYFLIGILLFYIDTAIGLLIPMHIGKFELVFVPHLTFMYILMMVVYRGFGVSLLLS
    Newman          MRTLYYFLIGILLFYIDTAIGLLIPMHIGKFELVFVPHLTFMYILMMVVYRGFGVSLLLS
    USA300_FPR3757  MRTLYYFLIGILLFYIDTAIGLLIPMHIGKFELVFVPHLTFMYILMMVVYRGFGVSLLLS
                    ************************************************************

    COL             IFLGVMTDVYFGSIYGVYLFGYILFLALIDRFFKIFYKDHSMLFIIILASTLLLEVYVAL
    N315            IFLGVMTDVYFGSIYGVYLFGYILFLALIDRFFKIFYKDHSMLFIIILASTLLLEVYVAL
    NCTC8325        IFLGVMTDVYFGSIYGVYLFGYILFLALIDRFFKIFYKDHSMLFIIILASTLLLEVYVAL
    Newman          IFLGVMTDVYFGSIYGVYLFGYILFLALIDRFFKIFYKDHSMLFIIILASTLLLEVYVAL
    USA300_FPR3757  IFLGVMTDVYFGSIYGVYLFGYILFLALIDRFFKIFYKDHSMLFIIILASTLLLEVYVAL
                    ************************************************************

    COL             IYGMLGFIQFDIIHFVVFRLLPTLIMNFVLLIMLYPLIIKFLKKTNNDIDMKRRQW
    N315            IYGMLGFIQFDIIHFVVFRLLPTLIMNFVLLIMLYPLIIKFLKKTNNDIDMKRRQW
    NCTC8325        IYGMLGFIQFDIIHFVVFRLLPTLIMNFVLLIMLYPLIIKFLKKTNNDIDMKRRQW
    Newman          IYGMLGFIQFDIIHFVVFRLLPTLIMNFVLLIMLYPLIIKFLKKTNNDIDMKRRQW
    USA300_FPR3757  IYGMLGFIQFDIIHFVVFRLLPTLIMNFVLLIMLYPLIIKFLKKTNNDIDMKRRQW
                    ********************************************************