From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004255000
  • symbol?: mreC
  • description?: rod shape-determining protein MreC

      descriptions from strain specific annotations:

    • rod shape-determining protein MreC
    • cell shape determining protein MreC
    • putative rod shape-determining protein
    • putative rod shape-determining protein MreC
  • strand?: -
  • coordinates?: 4501869..4502345
  • synteny block?: BlockID0032830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1704 (mreC)
    N315:
    NCTC8325:
    Newman:
    NWMN_1551 (mreC)
    USA300_FPR3757:
    04-02981:
    SA2981_1607 (mreC)
    08BA02176:
    C248_1692
    11819-97:
    MS7_1664 (mreC)
    71193:
    ST398NM01_1712
    ECT-R 2:
    ECTR2_1497 (mreC)
    ED133:
    SAOV_1646
    ED98:
    SAAV_1642 (mreC)
    HO 5096 0412:
    SAEMRSA15_15660
    JH1:
    SaurJH1_1739
    JH9:
    SaurJH9_1706
    JKD6008:
    SAA6008_01618 (mreC)
    JKD6159:
    SAA6159_01581 (mreC)
    LGA251:
    SARLGA251_15510
    M013:
    M013TW_1669
    MRSA252:
    SAR1729
    MSHR1132:
    SAMSHR1132_14850
    MSSA476:
    SAS1585
    Mu3:
    SAHV_1636
    Mu50:
    SAV1649
    MW2:
    MW1599
    RF122:
    SAB1518c
    ST398:
    SAPIG1712 (mreC)
    T0131:
    SAT0131_01750 (ung)
    TCH60:
    HMPREF0772_11493 (mreC)
    TW20:
    SATW20_16430
    USA300_TCH1516:
    USA300HOU_1648 (mreC)
    VC40:
    SAVC_07490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKFFKNNKLIVVLCAIIVFIALIGLSIRSQSQSPPEQYIGDSVSFGQRVVSYPVNFVAG
    N315            MLKFFKNNKLIVVLCAIIVFIALIGLSIRSQSQSPPEQYIGDSVSFGQRVVSYPVNFVAG
    NCTC8325        MLKFFKNNKLIVVLCAIIVFIALIGLSIRSQSQSPPEQYIGDSVSFGQRVVSYPVNFVAG
    Newman          MLKFFKNNKLIVVLCAIIVFIALIGLSIRSQSQSPPEQYIGDSVSFGQRVVSYPVNFVAG
    USA300_FPR3757  MLKFFKNNKLIVVLCAIIVFIALIGLSIRSQSQSPPEQYIGDSVSFGQRVVSYPVNFVAG
                    ************************************************************

    COL             TIGDFFKKGDSKESKNKISQLESKNQQLEAENEKLKKELDLKDISKFDPISTTVLARNPD
    N315            TIGDFFKKGDSKESKNKISQLESKNQQLEAENEKLKKELDLKDISKFDPISTTVLARNPD
    NCTC8325        TIGDFFKKGDSKESKNKISQLESKNQQLEAENEKLKKELDLKDISKFDPISTTVLARNPD
    Newman          TIGDFFKKGDSKESKNKISQLESKNQQLEAENEKLKKELDLKDISKFDPISTTVLARNPD
    USA300_FPR3757  TIGDFFKKGDSKESKNKISQLESKNQQLEAENEKLKKELDLKDISKFDPISTTVLARNPD
                    ************************************************************

    COL             QWMNTIVIDKGSKSGITSNMAVMTSQGFVGRVTKVNKFSSQVDLISTNTRAGKLSVNIQH
    N315            QWMNTIVIDKGSKSGITSNMAVMTSQGFVGRVTKVNKFSSQVDLISTNTRAGKLSVNIQH
    NCTC8325        QWMNTIVIDKGSKSGITSNMAVMTSQGFVGRVTKVNKFSSQVDLISTNTRAGKLSVNIQH
    Newman          QWMNTIVIDKGSKSGITSNMAVMTSQGFVGRVTKVNKFSSQVDLISTNTRAGKLSVNIQH
    USA300_FPR3757  QWMNTIVIDKGSKSGITSNMAVMTSQGFVGRVTKVNKFSSQVDLISTNTRAGKLSVNIQH
                    ************************************************************

    COL             GSKNIFGLIDRYDEKNSELVISDINNRDNISKGDKVVTSGLADQLPSNLYIGEVTKVQND
    N315            GSKNIFGLIDRYDEKNSELVISDINNRDNISKGDKVVTSGLADQLPSNLYIGEVTKVQND
    NCTC8325        GSKNIFGLIDRYDEKNSELVISDINNRDNISKGDKVVTSGLADQLPSNLYIGEVTKVQND
    Newman          GSKNIFGLIDRYDEKNSELVISDINNRDNISKGDKVVTSGLADQLPSNLYIGEVTKVQND
    USA300_FPR3757  GSKNIFGLIDRYDEKNSELVISDINNRDNISKGDKVVTSGLADQLPSNLYIGEVTKVQND
                    ************************************************************

    COL             QYGLAKEVRVKTGADLTDLSHVYVAKRDPKTIPDDESRDK
    N315            QYGLAKEVRVKTGADLTDLSHVYVAKRDPKTIPDDESRDK
    NCTC8325        QYGLAKEVRVKTGADLTDLSHVYVAKRDPKTIPDDESRDK
    Newman          QYGLAKEVRVKTGADLTDLSHVYVAKRDPKTIPDDESRDK
    USA300_FPR3757  QYGLAKEVRVKTGADLTDLSHVYVAKRDPKTIPDDESRDK
                    ****************************************