From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004272000
  • symbol?: comC
  • description?: Peptidase A24A domain protein

      descriptions from strain specific annotations:

    • Peptidase A24A domain protein
    • peptidase A24A domain-containing protein
    • type III leader peptidase family protein
    • Late competence protein ComC, processing protease
    • type IV leader peptidase family protein
    • A24 family peptidase
    • Type 4 prepilin-like proteins leader peptide-processing enzyme
    • leader peptidase protein
  • strand?: -
  • coordinates?: 4518782..4519490
  • synteny block?: BlockID0032960
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1620 (comC)
    08BA02176:
    C248_1703
    11819-97:
    MS7_1669
    71193:
    ST398NM01_1716
    ECT-R 2:
    ECTR2_1502
    ED133:
    SAOV_1650
    ED98:
    SAAV_1647
    HO 5096 0412:
    SAEMRSA15_15720
    JH1:
    SaurJH1_1753
    JH9:
    SaurJH9_1719
    JKD6008:
    SAA6008_01629
    JKD6159:
    SAA6159_01587
    LGA251:
    SARLGA251_15550
    M013:
    M013TW_1675
    MRSA252:
    SAR1741
    MSHR1132:
    MSSA476:
    SAS1590
    Mu3:
    SAHV_1648
    Mu50:
    SAV1661
    MW2:
    MW1605
    RF122:
    SAB1522c
    ST398:
    SAPIG1716
    T0131:
    SAT0131_01762 (mvaK1)
    TCH60:
    HMPREF0772_11488
    TW20:
    SATW20_16530
    USA300_TCH1516:
    USA300HOU_1653
    VC40:
    SAVC_07520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVVLLSYSCSCIFSFLYQFISIEETSFDYLHRRSKCDYCNSSLKWYELMPIISFLLLKGR
    N315            MVVLLSYSCSCIFSFLYQFISIEETSFDYLHRRSKCDYCNSSLKWYELMPIISFLLLKGR
    NCTC8325        MVVLLSYSCSCIFSFLYQFISIEETSFDYLHRRSKCDYCNSSLKWYELMPIISFLLLKGR
    Newman          MVVLLSYSCSCIFSFLYQFISIEETSFDYLHRRSKCDYCNSSLKWYELMPIISFLLLKGR
    USA300_FPR3757  MVVLLSYSCSCIFSFLYQFISIEETSFDYLHRRSKCDYCNSSLKWYELMPIISFLLLKGR
                    ************************************************************

    COL             CRNCRKRISLTHFLGETFALIPIVFIKYDFTYVNATLFITTYVFLLIFTMTDITSLMLDC
    N315            CRNCRKRISLTHFLGETFALIPIVFIKYDFTYVNATLFITTYVFLLIFTMTDITSLMLDC
    NCTC8325        CRNCRKRISLTHFLGETFALIPIVFIKYDFTYVNATLFITTYVFLLIFTMTDITSLMLDC
    Newman          CRNCRKRISLTHFLGETFALIPIVFIKYDFTYVNATLFITTYVFLLIFTMTDITSLMLDC
    USA300_FPR3757  CRNCRKRISLTHFLGETFALIPIVFIKYDFTYVNATLFITTYVFLLIFTMTDITSLMLDC
                    ************************************************************

    COL             RLIIIYCIVSLSLSMIYPVAFIIISMTTHIFYFLFRAYIGYGDVLLISALSLFFPLQFTI
    N315            RLIIIYCIVSLSLSMIYPVAFIIISMTTHIFYFLFRAYIGYGDVLLISALSLFFPLQFTI
    NCTC8325        RLIIIYCIVSLSLSMIYPVAFIIISMTTHIFYFLFRAYIGYGDVLLISALSLFFPLQFTI
    Newman          RLIIIYCIVSLSLSMIYPVAFIIISMTTHIFYFLFRAYIGYGDVLLISALSLFFPLQFTI
    USA300_FPR3757  RLIIIYCIVSLSLSMIYPVAFIIISMTTHIFYFLFRAYIGYGDVLLISALSLFFPLQFTI
                    ************************************************************

    COL             YVILFTFVIAGLVALITMIFKPIKLLPLVPFIFISFFINSLFYNDIHQFLGGVYF
    N315            YVILFTFVIAGLVALITMIFKPIKLLPLVPFIFISFFINSLFYNDIHQFLGGVYF
    NCTC8325        YVILFTFVIAGLVALITMIFKPIKLLPLVPFIFISFFINSLFYNDIHQFLGGVYF
    Newman          YVILFTFVIAGLVALITMIFKPIKLLPLVPFIFISFFINSLFYNDIHQFLGGVYF
    USA300_FPR3757  YVILFTFVIAGLVALITMIFKPIKLLPLVPFIFISFFINSLFYNDIHQFLGGVYF
                    *******************************************************