From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004274000
  • symbol?: folC
  • description?: bifunctional folylpolyglutamate synthase/dihydrofolate synthase

      descriptions from strain specific annotations:

    • bifunctional folylpolyglutamate synthase/dihydrofolate synthase
    • folylpolyglutamate synthase
    • folylpolyglutamate synthase/dihydrofolate synthase
    • Dihydrofolate synthase / Folylpolyglutamate synthase
    • folylpolyglutamate synthase (folylpoly-gamma-glutamatesynthetase) (fpgs) (tetrahydrofolate synthase)(tetrahydrofolylpolyglutamate synthase)
    • folylpolyglutamate synthase/dihydrofolate synthase protein
    • folypolyglutamate synthase
    • putative folylpolyglutamate synthase
    • tetrahydrofolate synthase
  • strand?: -
  • coordinates?: 4519767..4521038
  • synteny block?: BlockID0032980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1709 (folC)
    N315:
    SA1487 (folC)
    NCTC8325:
    Newman:
    NWMN_1557 (folC)
    USA300_FPR3757:
    04-02981:
    SA2981_1621 (folC)
    08BA02176:
    C248_1704 (folC)
    11819-97:
    MS7_1670 (folC)
    71193:
    ST398NM01_1717
    ECT-R 2:
    ECTR2_1503 (folC)
    ED133:
    SAOV_1651 (folC)
    ED98:
    SAAV_1648 (folC)
    HO 5096 0412:
    SAEMRSA15_15730 (folC)
    JH1:
    SaurJH1_1754
    JH9:
    SaurJH9_1720
    JKD6008:
    SAA6008_01630 (folC)
    JKD6159:
    SAA6159_01588 (folC)
    LGA251:
    SARLGA251_15560 (folC)
    M013:
    M013TW_1676
    MRSA252:
    SAR1742 (folC)
    MSHR1132:
    SAMSHR1132_14910
    MSSA476:
    SAS1591
    Mu3:
    SAHV_1649 (folC)
    Mu50:
    SAV1662 (folC)
    MW2:
    MW1606 (folC)
    RF122:
    SAB1523c (folC)
    ST398:
    SAPIG1717
    T0131:
    SAT0131_01763 (mvaD)
    TCH60:
    HMPREF0772_11487 (folC)
    TW20:
    SATW20_16540 (folC)
    USA300_TCH1516:
    USA300HOU_1654 (folC)
    VC40:
    SAVC_07525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYLESLYWIHERTKFGIKPGVKRMEWMLAQFNNPQNNIKGIHVGGTNGKGSTVAYLRTA
    N315            MNYLESLYWIHERTKFGIKPGVKRMEWMLAQFNNPQNNIKGIHVGGTNGKGSTVAYLRTA
    NCTC8325        MNYLESLYWIHERTKFGIKPGVKRMEWMLAQFNNPQNNIKGIHVGGTNGKGSTVAYLRTA
    Newman          MNYLESLYWIHERTKFGIKPGVKRMEWMLAQFNNPQNNIKGIHVGGTNGKGSTVAYLRTA
    USA300_FPR3757  MNYLESLYWIHERTKFGIKPGVKRMEWMLAQFNNPQNNIKGIHVGGTNGKGSTVAYLRTA
                    ************************************************************

    COL             LVENGYEVGTFTSPFIETFNERISLNGVPISNDAIVELVSRIKPVSEMMERETDLGVATE
    N315            LVENGYEVGTFTSPFIETFNERISLNGVPISNDAIVELVSRIKPVSEMMERETDLGVATE
    NCTC8325        LVENGYEVGTFTSPFIETFNERISLNGVPISNDAIVELVSRIKPVSEMMERETDLGVATE
    Newman          LVENGYEVGTFTSPFIETFNERISLNGVPISNDAIVELVSRIKPVSEMMERETDLGVATE
    USA300_FPR3757  LVENGYEVGTFTSPFIETFNERISLNGVPISNDAIVELVSRIKPVSEMMERETDLGVATE
                    ************************************************************

    COL             FEIITAMMFLYFGEIHPVDFVIVEAGLGIKNDSTNVFTPVLSILTSIGLDHTDILGGTYL
    N315            FEIITAMMFLYFGEIHPVDFVIVEAGLGIKNDSTNVFTPVLSILTSIGLDHTDILGGTYL
    NCTC8325        FEIITAMMFLYFGEIHPVDFVIVEAGLGIKNDSTNVFTPVLSILTSIGLDHTDILGGTYL
    Newman          FEIITAMMFLYFGEIHPVDFVIVEAGLGIKNDSTNVFTPVLSILTSIGLDHTDILGGTYL
    USA300_FPR3757  FEIITAMMFLYFGEIHPVDFVIVEAGLGIKNDSTNVFTPVLSILTSIGLDHTDILGGTYL
                    ************************************************************

    COL             DIARDKGAIIKPNVPVIYAVKNEDALKYVRERAIEQHAKPIELDREIVVVSQNDEFTYRY
    N315            DIARDKGAIIKPNVPVIYAVKNEDALKYVRERAIEQHAKPIELDREIVVVSQNDEFTYRY
    NCTC8325        DIARDKGAIIKPNVPVIYAVKNEDALKYVRERAIEQHAKPIELDREIVVVSQNDEFTYRY
    Newman          DIARDKGAIIKPNVPVIYAVKNEDALKYVRERAIEQHAKPIELDREIVVVSQNDEFTYRY
    USA300_FPR3757  DIARDKGAIIKPNVPVIYAVKNEDALKYVRERAIEQHAKPIELDREIVVVSQNDEFTYRY
                    ************************************************************

    COL             KDYELETIILSMLGEHQKQNAALAITALIELNEQGLIELDFNKMIDGIESVRWTGRIEQV
    N315            KDYELETIILSMLGEHQKQNAALAITALIELNEQGLIELDFNKMIDGIESVRWTGRIEQV
    NCTC8325        KDYELETIILSMLGEHQKQNAALAITALIELNEQGLIELDFNKMIDGIESVRWTGRIEQV
    Newman          KDYELETIILSMLGEHQKQNAALAITALIELNEQGLIELDFNKMIDGIESVRWTGRIEQV
    USA300_FPR3757  KDYELETIILSMLGEHQKQNAALAITALIELNEQGLIELDFNKMIDGIESVRWTGRIEQV
                    ************************************************************

    COL             HDKPLIILDGAHNSESIDALIDTIKQYHDKEKVDILFSAINGKPINEMVKHLSLIAHTFY
    N315            HDKPLIILDGAHNSESIDALIDTIKQYHDKEKVDILFSAINGKPINEMVKHLSLIAHTFY
    NCTC8325        HDKPLIILDGAHNSESIDALIDTIKQYHDKEKVDILFSAINGKPINEMVKHLSLIAHTFY
    Newman          HDKPLIILDGAHNSESIDALIDTIKQYHDKEKVDILFSAINGKPINEMVKHLSLIAHTFY
    USA300_FPR3757  HDKPLIILDGAHNSESIDALIDTIKQYHDKEKVDILFSAINGKPINEMVKHLSLIAHTFY
                    ************************************************************

    COL             ATEFDFPKALRKEEIVGSIENDEIQLVDDYVEFIKNYQGDTLVITGSLYFISEVKSKLDF
    N315            ATEFDFPKALRKEEIVGSIENDEIQLVDDYVEFIKNYQGDTLVITGSLYFISEVKSKLDF
    NCTC8325        ATEFDFPKALRKEEIVGSIENDEIQLVDDYVEFIKNYQGDTLVITGSLYFISEVKSKLDF
    Newman          ATEFDFPKALRKEEIVGSIENDEIQLVDDYVEFIKNYQGDTLVITGSLYFISEVKSKLDF
    USA300_FPR3757  ATEFDFPKALRKEEIVGSIENDEIQLVDDYVEFIKNYQGDTLVITGSLYFISEVKSKLDF
                    ************************************************************

    COL             EAL
    N315            EAL
    NCTC8325        EAL
    Newman          EAL
    USA300_FPR3757  EAL
                    ***