From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004278000
  • symbol?:
  • description?: ammonia monooxygenase

      descriptions from strain specific annotations:

    • ammonia monooxygenase
    • abrB protein, putative
    • membrane protein AbrB duplication domain protein
    • putative abrB protein
    • putative ammonia monooxygenase
    • membrane AbrB duplication domain protein
    • YhjN protein
    • Abrb
  • strand?: -
  • coordinates?: 4524885..4525577
  • synteny block?: BlockID0033020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1560 (abrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1624
    08BA02176:
    C248_1707
    11819-97:
    MS7_1673
    71193:
    ST398NM01_1720
    ECT-R 2:
    ECTR2_1506
    ED133:
    SAOV_1654
    ED98:
    SAAV_1652
    HO 5096 0412:
    SAEMRSA15_15760
    JH1:
    SaurJH1_1757
    JH9:
    SaurJH9_1723
    JKD6008:
    SAA6008_01634 (amoA)
    JKD6159:
    SAA6159_01591 (amoA)
    LGA251:
    SARLGA251_15590
    M013:
    M013TW_1680
    MRSA252:
    SAR1745
    MSHR1132:
    SAMSHR1132_14940
    MSSA476:
    SAS1594
    Mu3:
    SAHV_1652
    Mu50:
    SAV1665
    MW2:
    MW1609
    RF122:
    SAB1526c
    ST398:
    SAPIG1720
    T0131:
    SAT0131_01767
    TCH60:
    HMPREF0772_11484
    TW20:
    SATW20_16570
    USA300_TCH1516:
    USA300HOU_1657
    VC40:
    SAVC_07540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAMIYRNNFIVFVLSFFISILLYSSHVLLPFMFGPIIASIICVKVFKLDIKWPFLLSELG
    N315            MTMIYRNNFIVFVLSFFISIILYSSHVLLPFMFGPIIASIICVKVFKLDIKWPFLLSELG
    NCTC8325        MAMIYRNNFIVFVLSFFISILLYSSHVLLPFMFGPIIASIICVKVFKLDIKWPFLLSELG
    Newman          --MIYRNNFIVFVLSFFISILLYSSHVLLPFMFGPIIASIICVKVFKLDIKWPFLLSELG
    USA300_FPR3757  MAMIYRNNFIVFVLSFFISILLYSSHVLLPFMFGPIIASIICVKVFKLDIKWPFLLSELG
                      ******************:***************************************

    COL             IVLLGVQIGSTFTKNVVMDIKNNWLSIIVVSISILLIAIVMAFVFKKIARINTETAILSV
    N315            IVLLGVQIGSTFTKNVVMDIKNNWLSIIVVSISILLIAIVMAFIFKKIARINTETAILSV
    NCTC8325        IVLLGVQIGSTFTKNVVMDIKNNWLSIIVVSISILLIAIVMAFVFKKIARINTETAILSV
    Newman          IVLLGVQIGSTFTKNVVMDIKNNWLSIIVVSISILLIAIVMAFVFKKIARINTETAILSV
    USA300_FPR3757  IVLLGVQIGSTFTKNVVMDIKNNWLSIIVVSISILLIAIVMAFVFKKIARINTETAILSV
                    *******************************************:****************

    COL             IPGALTQMLVMAEQDKRANLLVVSLTQTSRIIFVVVLVPFISYFFHDGNMHANGKLTKVL
    N315            IPGALTQMLVMAEQDKRANLLVVSLTQTSRIIFVVVLVPFISYFFHDGNMHANGKLTKVL
    NCTC8325        IPGALTQMLVMAEQDKRANLLVVSLTQTSRIIFVVVLVPFISYFFHDGNMHANGKLTKVL
    Newman          IPGALTQMLVMAEQDKRANLLVVSLTQTSRIIFVVVLVPFISYFFHDGNMHANGKLTKVL
    USA300_FPR3757  IPGALTQMLVMAEQDKRANLLVVSLTQTSRIIFVVVLVPFISYFFHDGNMHANGKLTKVL
                    ************************************************************

    COL             PLSQVLNIGQIVILAIAIFIVYLIMSKIKFPTFQLLAPLIVLIVWNFSTGLTFTLDHWLL
    N315            PLSQVLNIGQIVILAIAIFIVYLIMSKIKFPTFQLLAPLIVLIVWNFSTGLTFTLDHWLL
    NCTC8325        PLSQVLNIGQIVILAIAIFIVYLIMSKIKFPTFQLLAPLIVLIVWNFSTGLTFTLDHWLL
    Newman          PLSQVLNIGQIVILAIAIFIVYLIMSKIKFPTFQLLAPLIVLIVWNFSTGLTFTLDHWLL
    USA300_FPR3757  PLSQVLNIGQIVILAIAIFIVYLIMSKIKFPTFQLLAPLIVLIVWNFSTGLTFTLDHWLL
                    ************************************************************

    COL             NMAQLIYMIRIGVQIAHLLSDLKGRLAIAITIQNIMLIIGALIMVYIIHFFDNNPINELF
    N315            NMAQLIYMIRIGVQIAHLLSDLKGRLAIAITIQNIMLIIGALIMVYIIHFFDNNPINELF
    NCTC8325        NMAQLIYMIRIGVQIAHLLSDLKGRLAIAITIQNIMLIIGALIMVYIIHFFDNNPINELF
    Newman          NMAQLIYMIRIGVQIAHLLSDLKGRLAIAITIQNIMLIIGALIMVYIIHFFDNNPINELF
    USA300_FPR3757  NMAQLIYMIRIGVQIAHLLSDLKGRLAIAITIQNIMLIIGALIMVYIIHFFDNNPINELF
                    ************************************************************

    COL             LGAAPGGVNQIVLVALATGADVAMITSYHIFRIFFILFIIAPGINYFLKYRSNKRED
    N315            LGAAPGGVNQIVLVALATGADVAMITSYHIFRIFFILFIIAPGINYFLKYRSNKRED
    NCTC8325        LGAAPGGVNQIVLVALATGADVAMITSYHIFRIFFILFIIAPGINYFLKYRSNKRED
    Newman          LGAAPGGVNQIVLVALATGADVAMITSYHIFRIFFILFIIAPGINYFLKYRSNKRED
    USA300_FPR3757  LGAAPGGVNQIVLVALATGADVAMITSYHIFRIFFILFIIAPGINYFLKYRSNKRED
                    *********************************************************