From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004284000
  • symbol?: hemD
  • description?: uroporphyrinogen III synthase

      descriptions from strain specific annotations:

    • uroporphyrinogen III synthase
    • uroporphyrinogen-III synthase HemD family protein
    • uroporphyrinogen III synthase HEM4
  • strand?: -
  • coordinates?: 4528488..4529163
  • synteny block?: BlockID0033080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1716 (hemD)
    N315:
    SA1493 (hemD)
    NCTC8325:
    Newman:
    NWMN_1563 (hemD)
    USA300_FPR3757:
    04-02981:
    SA2981_1629 (hemD)
    08BA02176:
    C248_1710 (hemD)
    11819-97:
    MS7_1677
    71193:
    ST398NM01_1724
    ECT-R 2:
    ECTR2_1510
    ED133:
    SAOV_1658 (hemD)
    ED98:
    SAAV_1656 (hemD)
    HO 5096 0412:
    SAEMRSA15_15800 (hemD)
    JH1:
    SaurJH1_1761
    JH9:
    SaurJH9_1727
    JKD6008:
    SAA6008_01637 (hemD)
    JKD6159:
    SAA6159_01594 (hemD)
    LGA251:
    SARLGA251_15620 (hemD)
    M013:
    M013TW_1683
    MRSA252:
    SAR1749 (hemD)
    MSHR1132:
    SAMSHR1132_14970
    MSSA476:
    SAS1598
    Mu3:
    SAHV_1656 (hemD)
    Mu50:
    SAV1669 (hemD)
    MW2:
    MW1613 (hemD)
    RF122:
    SAB1529c (hemD)
    ST398:
    SAPIG1724 (hemD)
    T0131:
    SAT0131_01770
    TCH60:
    HMPREF0772_11481 (hemD)
    TW20:
    SATW20_16600 (hemD)
    USA300_TCH1516:
    USA300HOU_1661 (hemD)
    VC40:
    SAVC_07555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
    N315            MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
    NCTC8325        MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
    Newman          MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
    USA300_FPR3757  MKPVVVMTQTNDMQSDLVSIIHKPFIDIKPLNFDIHLLNQRYDWLIFSSKNAVKFFYKYL
                    ************************************************************

    COL             KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
    N315            KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
    NCTC8325        KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
    Newman          KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
    USA300_FPR3757  KGINVDNIAVIGSKTAQYCESLGIRVDFMPNDFSQEGFLKSFNQTNQKILLPSSELARPL
                    ************************************************************

    COL             LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
    N315            LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
    NCTC8325        LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
    Newman          LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
    USA300_FPR3757  LLAALSKDNEVVKIDLYTSVPNKQNIQDVKEMIEHQQIDALTFSSSSAVRYYFNEGFVPK
                    ************************************************************

    COL             FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
    N315            FKSYFAIGEQTARTIKTYQQPVTIAEIQTLESLIEKILESRG
    NCTC8325        FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
    Newman          FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
    USA300_FPR3757  FKSYFAIGEQTARTIKSYQQPVTIAEIQTLESLIEKILESRG
                    ****************:*************************