From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004286000
  • symbol?: hemX
  • description?: hemA concentration negative effector hemX

      descriptions from strain specific annotations:

    • hemA concentration negative effector hemX
    • cytochrome c assembly protein
    • HemX protein, negative effector of steady-state concentration of glutamyl-tRNA reductase hemA
    • cytochrome C assembly family protein
    • hemX protein
    • HemX family protein
    • uroporphyrin-III C-methyltransferase
    • membrane uroporphyrinogen III methylase
    • heme export permease
  • strand?: -
  • coordinates?: 4530153..4530968
  • synteny block?: BlockID0033100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1495 (hemX)
    NCTC8325:
    Newman:
    NWMN_1565 (hemX)
    USA300_FPR3757:
    04-02981:
    SA2981_1631 (hemX)
    08BA02176:
    C248_1712
    11819-97:
    MS7_1679
    71193:
    ST398NM01_1726
    ECT-R 2:
    ECTR2_1512
    ED133:
    SAOV_1660
    ED98:
    SAAV_1658
    HO 5096 0412:
    SAEMRSA15_15820
    JH1:
    SaurJH1_1763
    JH9:
    SaurJH9_1729
    JKD6008:
    SAA6008_01639 (hemX)
    JKD6159:
    SAA6159_01596 (hemX)
    LGA251:
    SARLGA251_15640
    M013:
    M013TW_1685
    MRSA252:
    SAR1751
    MSHR1132:
    SAMSHR1132_14990
    MSSA476:
    SAS1600
    Mu3:
    SAHV_1658 (hemX)
    Mu50:
    SAV1671 (hemX)
    MW2:
    MW1615 (hemX)
    RF122:
    SAB1531c
    ST398:
    SAPIG1726
    T0131:
    SAT0131_01773
    TCH60:
    HMPREF0772_11479 (hemX)
    TW20:
    SATW20_16620
    USA300_TCH1516:
    USA300HOU_1663
    VC40:
    SAVC_07565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQENLFIRFNEIILLIYLISIICYFYDFVQKSHKIRSLGIYLLGIVWVLQTISLSIFIIQ
    N315            MQENLFIRFNEIILLIYLISIICYFYDFVQKSHKIRSLGIYLLGIVWVLQTISLSIFIIQ
    NCTC8325        MQENLFIRFNEIILLIYLISIICYFYDFVQKSHKIRSLGIYLLGIVWVLQTISLSIFIIQ
    Newman          MQENLFIRFNEIILLIYLISIICYFYDFVQKSHKIRSLGIYLLGIVWVLQTISLSIFIIQ
    USA300_FPR3757  MQENLFIRFNEIILLIYLISIICYFYDFVQKSHKIRSLGIYLLGIVWVLQTISLSIFIIQ
                    ************************************************************

    COL             TRHIPLGSISDVFYTLSWLIISISLILNLIKVLNFSVFFLNLIGLTLLGMNTFQPTHYTN
    N315            TRHIPLGSISDVFYTLSWLIISISLILNLIKVLNFSVFFLNLIGLTLLGMNTFQPTHYTN
    NCTC8325        TRHIPLGSISDVFYTLSWLIISISLILNLIKVLNFSVFFLNLIGLTLLGMNTFQPTHYTN
    Newman          TRHIPLGSISDVFYTLSWLIISISLILNLIKVLNFSVFFLNLIGLTLLGMNTFQPTHYTN
    USA300_FPR3757  TRHIPLGSISDVFYTLSWLIISISLILNLIKVLNFSVFFLNLIGLTLLGMNTFQPTHYTN
                    ************************************************************

    COL             KVQKIAVVDELLLVHIGLAVLSYVFFALAFVNALLYIMQYRNLKEKRFDQKYFRIGSVAT
    N315            KVQKIAVVDELLLVHIGLAVLSYVFFALAFVNALLYIMQYRNLKEKRFDQKYFRIGSVAT
    NCTC8325        KVQKIAVVDELLLVHIGLAVLSYVFFALAFVNALLYIMQYRNLKEKRFDQKYFRIGSVAT
    Newman          KVQKIAVVDELLLVHIGLAVLSYVFFALAFVNALLYIMQYRNLKEKRFDQKYFRIGSVAT
    USA300_FPR3757  KVQKIAVVDELLLVHIGLAVLSYVFFALAFVNALLYIMQYRNLKEKRFDQKYFRIGSVAT
                    ************************************************************

    COL             LESIVFYSTLSGWIILIFSIILGTQWGVISVGERIFIDPKVILSSIITVLYGSYILLRIN
    N315            LESIVFYSTLSGWIILIFSIILGTQWGVISVGERIFIDPKVILSSIITVLYGSYILLRIN
    NCTC8325        LESIVFYSTLSGWIILIFSIILGTQWGVISVGERIFIDPKVILSSIITVLYGSYILLRIN
    Newman          LESIVFYSTLSGWIILIFSIILGTQWGVISVGERIFIDPKVILSSIITVLYGSYILLRIN
    USA300_FPR3757  LESIVFYSTLSGWIILIFSIILGTQWGVISVGERIFIDPKVILSSIITVLYGSYILLRIN
                    ************************************************************

    COL             KWLNSRYLIYYNIILFCLNMINLFFATHFVN
    N315            KWLNSRYLIYYNIILFCLNMINLFFATHFVN
    NCTC8325        KWLNSRYLIYYNIILFCLNMINLFFATHFVN
    Newman          KWLNSRYLIYYNIILFCLNMINLFFATHFVN
    USA300_FPR3757  KWLNSRYLIYYNIILFCLNMINLFFATHFVN
                    *******************************