From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004290000
  • symbol?: clpX
  • description?: ATP-dependent protease ATP-binding subunit ClpX

      descriptions from strain specific annotations:

    • ATP-dependent protease ATP-binding subunit ClpX
    • ATP-dependent Clp protease ATP-binding subunit ClpX
    • ATP-dependent Clp protease, ATP-binding subunit ClpX
    • ATP-dependent endopeptidase clp ATP-binding subunit
  • strand?: -
  • coordinates?: 4534825..4536087
  • synteny block?: BlockID0033140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1721 (clpX)
    N315:
    SA1498 (clpX)
    NCTC8325:
    Newman:
    NWMN_1568 (clpX)
    USA300_FPR3757:
    04-02981:
    SA2981_1634 (clpX)
    08BA02176:
    C248_1715 (clpX)
    11819-97:
    MS7_1682 (clpX)
    71193:
    ST398NM01_1729
    ECT-R 2:
    ECTR2_1515 (clpX)
    ED133:
    SAOV_1663 (clpX)
    ED98:
    SAAV_1662 (clpX)
    HO 5096 0412:
    SAEMRSA15_15850 (clpX)
    JH1:
    SaurJH1_1766 (clpX)
    JH9:
    SaurJH9_1732 (clpX)
    JKD6008:
    SAA6008_01642 (clpX)
    JKD6159:
    SAA6159_01599 (clpX)
    LGA251:
    SARLGA251_15670 (clpX)
    M013:
    M013TW_1688
    MRSA252:
    SAR1754 (clpX)
    MSHR1132:
    SAMSHR1132_15020
    MSSA476:
    SAS1603 (clpX)
    Mu3:
    SAHV_1661 (clpX)
    Mu50:
    SAV1674 (clpX)
    MW2:
    MW1618 (clpX)
    RF122:
    SAB1534c (clpX)
    ST398:
    SAPIG1729 (clpX)
    T0131:
    SAT0131_01776
    TCH60:
    HMPREF0772_11476 (clpX)
    TW20:
    SATW20_16650 (clpX)
    USA300_TCH1516:
    USA300HOU_1666 (clpX)
    VC40:
    SAVC_07580 (clpX)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
    N315            MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
    NCTC8325        MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
    Newman          MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
    USA300_FPR3757  MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
                    ************************************************************

    COL             LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
    N315            LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
    NCTC8325        LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
    Newman          LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
    USA300_FPR3757  LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
                    ************************************************************

    COL             SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
    N315            SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
    NCTC8325        SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
    Newman          SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
    USA300_FPR3757  SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
                    ************************************************************

    COL             VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
    N315            VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
    NCTC8325        VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
    Newman          VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
    USA300_FPR3757  VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
                    ************************************************************

    COL             ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
    N315            ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
    NCTC8325        ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
    Newman          ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
    USA300_FPR3757  ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
                    ************************************************************

    COL             RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
    N315            RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
    NCTC8325        RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
    Newman          RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
    USA300_FPR3757  RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
                    ************************************************************

    COL             TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
    N315            TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
    NCTC8325        TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
    Newman          TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
    USA300_FPR3757  TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
                    ************************************************************