From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004301000
  • symbol?: lysP
  • description?: lysine-specific permease

      descriptions from strain specific annotations:

    • lysine-specific permease
    • amino-acid permease
    • APC family amino acid-polyamine-organocation transporter
    • lysine-specific permease LysP
    • amino acid permease family protein
    • APC family lysine-specific permease
  • strand?: -
  • coordinates?: 4540804..4542297
  • synteny block?: BlockID0033250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1505 (lysP)
    NCTC8325:
    Newman:
    NWMN_1575 (lysP)
    USA300_FPR3757:
    04-02981:
    SA2981_1641 (lysP)
    08BA02176:
    C248_1723 (lysP)
    11819-97:
    MS7_1689
    71193:
    ST398NM01_1736
    ECT-R 2:
    ECTR2_1522
    ED133:
    SAOV_1670 (lysP)
    ED98:
    SAAV_1670
    HO 5096 0412:
    SAEMRSA15_15920 (lysP)
    JH1:
    SaurJH1_1773
    JH9:
    SaurJH9_1739
    JKD6008:
    SAA6008_01649 (lysP)
    JKD6159:
    SAA6159_01606 (lysP)
    LGA251:
    SARLGA251_15740 (lysP)
    M013:
    M013TW_1695
    MRSA252:
    SAR1761 (lysP)
    MSHR1132:
    SAMSHR1132_15090
    MSSA476:
    SAS1610
    Mu3:
    SAHV_1668
    Mu50:
    SAV1681
    MW2:
    MW1625 (lysP)
    RF122:
    SAB1541c (lysP)
    ST398:
    SAPIG1736
    T0131:
    SAT0131_01784 (argS)
    TCH60:
    HMPREF0772_11469 (lysP)
    TW20:
    SATW20_16720 (lysP)
    USA300_TCH1516:
    USA300HOU_1668 (lysP)
    VC40:
    SAVC_07615 (lysP)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKVQNESNNVVKRGLKDRHISMIAIGGCIGTGLFVTSGGAIHDAGALGALIGYAIIGIM
    N315            MSKVQNESNNVVKRGLKDRHISMIAIGGCIGTGLFVTSGGAIHDAGALGALIGYAIIGIM
    NCTC8325        MSKVQNESNNVVKRGLKDRHISMIAIGGCIGTGLFVTSGGAIHDAGALGALIGYAIIGIM
    Newman          MSKVQNESNNVVKRGLKDRHISMIAIGGCIGTGLFVTSGGAIHDAGALGALIGYAIIGIM
    USA300_FPR3757  MSKVQNESNNVVKRGLKDRHISMIAIGGCIGTGLFVTSGGAIHDAGALGALIGYAIIGIM
                    ************************************************************

    COL             VFFLMTSLGEMATYLPVSGSFSTYATRFVDPSLGFALGWNYWFNWVVTVAADITIAAQVI
    N315            VFFLMTSLGEMATYLPVSGSFSTYATRFVDPSLGFALGWNYWFNWVVTVAADITIAAQVI
    NCTC8325        VFFLMTSLGEMATYLPVSGSFSTYATRFVDPSLGFALGWNYWFNWVVTVAADITIAAQVI
    Newman          VFFLMTSLGEMATYLPVSGSFSTYATRFVDPSLGFALGWNYWFNWVVTVAADITIAAQVI
    USA300_FPR3757  VFFLMTSLGEMATYLPVSGSFSTYATRFVDPSLGFALGWNYWFNWVVTVAADITIAAQVI
                    ************************************************************

    COL             QYWTPLQGIPAWAWSALFLVIIFSLNSLSVRVYGESEYWLALIKVVTVIVFIAIGLLTIV
    N315            QYWTPLQGIPAWAWSALFLVIIFSLNSLSVRVYGESEYWLALIKVITVIVFIAIGLLTIV
    NCTC8325        QYWTPLQGIPAWAWSALFLVIIFSLNSLSVRVYGESEYWLALIKVVTVIVFIAIGLLTIV
    Newman          QYWTPLQGIPAWAWSALFLVIIFSLNSLSVRVYGESEYWLALIKVVTVIVFIAIGLLTIV
    USA300_FPR3757  QYWTPLQGIPAWAWSALFLVIIFSLNSLSVRVYGESEYWLALIKVVTVIVFIAIGLLTIV
                    *********************************************:**************

    COL             GIMGGHVVGFEIFNKGEGPILGGNLGGSLLSILGVFLIAGFSFQGTELIGITAGESENPE
    N315            GIMGGHVVGFEIFNKGEGPILGGNLGGSLLSILGVFLIAGFSFQGTELIGITAGESENPE
    NCTC8325        GIMGGHVVGFEIFNKGEGPILGGNLGGSLLSILGVFLIAGFSFQGTELIGITAGESENPE
    Newman          GIMGGHVVGFEIFNKGEGPILGGNLGGSLLSILGVFLIAGFSFQGTELIGITAGESENPE
    USA300_FPR3757  GIMGGHVVGFEIFNKGEGPILGGNLGGSLLSILGVFLIAGFSFQGTELIGITAGESENPE
                    ************************************************************

    COL             RAVPKAIKQVFWRILLFYILAIFVIGMLIPYDSSALMGGSDNVATSPFTLVFKNAGFAFA
    N315            RAVPKAIKQVFWRILLFYILAIFVIGMLIPYDSSALMGGSDNVATSPFTLVFKNAGFAFA
    NCTC8325        RAVPKAIKQVFWRILLFYILAIFVIGMLIPYDSSALMGGSDNVATSPFTLVFKNAGFAFA
    Newman          RAVPKAIKQVFWRILLFYILAIFVIGMLIPYDSSALMGGSDNVATSPFTLVFKNAGFAFA
    USA300_FPR3757  RAVPKAIKQVFWRILLFYILAIFVIGMLIPYDSSALMGGSDNVATSPFTLVFKNAGFAFA
                    ************************************************************

    COL             ASFMNAVILTSVLSAGNSGMYASTRMLYSMSKDKLAFEAFGKTNKNGVPYMSLLVTAIIV
    N315            ASFMNAVILTSVLSAGNSGMYASTRMLYSMSKDKLAFEAFGKTNKNGVPYMSLLVTAIIV
    NCTC8325        ASFMNAVILTSVLSAGNSGMYASTRMLYSMSKDKLAFEAFGKTNKNGVPYMSLLVTAIIV
    Newman          ASFMNAVILTSVLSAGNSGMYASTRMLYSMSKDKLAFEAFGKTNKNGVPYMSLLVTAIIV
    USA300_FPR3757  ASFMNAVILTSVLSAGNSGMYASTRMLYSMSKDKLAFEAFGKTNKNGVPYMSLLVTAIIV
                    ************************************************************

    COL             VIIFVLQSLTKGAYEYIVAASGLTGFIAWVGIAVSHYRFRRAFDKQNYDKSKLKYTAKLF
    N315            VIIFVLQSLTKGAYEYIVAASGLTGFIAWVGIAVSHYRFRRAFDKQNYDKSKLKYTAKLF
    NCTC8325        VIIFVLQSLTKGAYEYIVAASGLTGFIAWVGIAVSHYRFRRAFDKQNYDKSKLKYTAKLF
    Newman          VIIFVLQSLTKGAYEYIVAASGLTGFIAWVGIAVSHYRFRRAFDKQNYDKSKLKYTAKLF
    USA300_FPR3757  VIIFVLQSLTKGAYEYIVAASGLTGFIAWVGIAVSHYRFRRAFDKQNYDKSKLKYTAKLF
                    ************************************************************

    COL             PFGPLFAGFLCIVVIIGQDVDFIKTGDFNFSRFLITYMGIPVFLAFFIYHKLRYKTKKIP
    N315            PFGPLFAGFLCIVVIIGQDVDFIKTGDFNFSRFLITYMGIPVFLAFFIYHKLRYKTKKIP
    NCTC8325        PFGPLFAGFLCIVVIIGQDVDFIKTGDFNFSRFLITYMGIPVFLAFFIYHKLRYKTKKIP
    Newman          PFGPLFAGFLCIVVIIGQDVDFIKTGDFNFSRFLITYMGIPVFLAFFIYHKLRYKTKKIP
    USA300_FPR3757  PFGPLFAGFLCIVVIIGQDVDFIKTGDFNFSRFLITYMGIPVFLAFFIYHKLRYKTKKIP
                    ************************************************************

    COL             LEQVDLRQDVSMDEIKG
    N315            LEQVDLRQDVSMDEIKG
    NCTC8325        LEQVDLRQDVSMDEIKG
    Newman          LEQVDLRQDVSMDEIKG
    USA300_FPR3757  LEQVDLRQDVSMDEIKG
                    *****************