From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004307000
  • symbol?: dnaB
  • description?: chromosome replication initiation/membrane attachment protein

      descriptions from strain specific annotations:

    • chromosome replication initiation/membrane attachment protein
    • replication initiation and membrane attachment family protein
    • replication initiation and membrane attachment protein
    • Helicase loader DnaB
    • replication initiation and membrane attachment protein (DnaB) family protein
    • replicative DNA helicase
    • chromosome replication initiation and membrane attachment protein
    • replicative DNA helicase DnaB
  • strand?: -
  • coordinates?: 4546010..4547433
  • synteny block?: BlockID0033310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1508 (dnaB)
    NCTC8325:
    Newman:
    NWMN_1578 (dnaB)
    USA300_FPR3757:
    04-02981:
    SA2981_1644 (dnaB)
    08BA02176:
    C248_1727 (dnaB)
    11819-97:
    MS7_1692
    71193:
    ST398NM01_1739
    ECT-R 2:
    ECTR2_1525
    ED133:
    SAOV_1673
    ED98:
    SAAV_1675
    HO 5096 0412:
    SAEMRSA15_15950 (dnaB)
    JH1:
    SaurJH1_1776
    JH9:
    SaurJH9_1742
    JKD6008:
    SAA6008_01652 (dnaB)
    JKD6159:
    SAA6159_01609 (dnaB)
    LGA251:
    SARLGA251_15770 (dnaB)
    M013:
    M013TW_1698
    MRSA252:
    SAR1764 (dnaB)
    MSHR1132:
    SAMSHR1132_15120
    MSSA476:
    SAS1613
    Mu3:
    SAHV_1671 (dnaB)
    Mu50:
    SAV1685 (dnaB)
    MW2:
    MW1628 (dnaB)
    RF122:
    SAB1544c (dnaB)
    ST398:
    SAPIG1739
    T0131:
    SAT0131_01787
    TCH60:
    HMPREF0772_11466 (dnaB2)
    TW20:
    SATW20_16750 (dnaB)
    USA300_TCH1516:
    USA300HOU_1672 (dnaB2)
    VC40:
    SAVC_07630

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGRQAFEFGLRPKDQFKVMQHFDLNTNHLEVLNRLYTPLIGTQAVGLYHFMTQFVKESHN
    N315            MGRQAFEFGLRPKDQFKVMQHFDLNTNHLEVLNRLYTPLIGTQAVGLYHFMTQFVKDSHN
    NCTC8325        MGRQAFEFGLRPKDQFKVMQHFDLNTNHLEVLNRLYTPLIGTQAVGLYHFMTQFVKESHN
    Newman          MGRQAFEFGLRPKDQFKVMQHFDLNTNHLEVLNRLYTPLIGTQAVGLYHFMTQFVKESHN
    USA300_FPR3757  MGRQAFEFGLRPKDQFKVMQHFDLNTNHLEVLNRLYTPLIGTQAVGLYHFMTQFVKESHN
                    ********************************************************:***

    COL             ETLILSHYIFMNELKINLLEFRQQMDLLEAIGLLKAFVKHDEQETQFVYQLIQPPSAHLF
    N315            ETLILSHYIFMNELKINLLEFRQQMDLLEAIGLLKAFVKHDEQETQFVYQLIQPPSAHLF
    NCTC8325        ETLILSHYIFMNELKINLLEFRQQMDLLEAIGLLKAFVKHDEQETQFVYQLIQPPSAHLF
    Newman          ETLILSHYIFMNELKINLLEFRQQMDLLEAIGLLKAFVKHDEQETQFVYQLIQPPSAHLF
    USA300_FPR3757  ETLILSHYIFMNELKINLLEFRQQMDLLEAIGLLKAFVKHDEQETQFVYQLIQPPSAHLF
                    ************************************************************

    COL             FNDPMLSIFLYSEVEHRRFHELKKYFEYQQIDLSEFKQVTRQFTDVFKVPSTKIDIDTSD
    N315            FNDPMLSIFLYSEVEHRRFHELKKYFEYQQIDLSEFKQVTRQFTDVFKVPSTKIDIDTSD
    NCTC8325        FNDPMLSIFLYSEVEHRRFHELKKYFEYQQIDLSEFKQVTRQFTDVFKVPSTKIDIDTSD
    Newman          FNDPMLSIFLYSEVEHRRFHELKKYFEYQQIDLSEFKQVTRQFTDVFKVPSTKIDIDTSD
    USA300_FPR3757  FNDPMLSIFLYSEVEHRRFHELKKYFEYQQIDLSEFKQVTRQFTDVFKVPSTKIDIDTSD
                    ************************************************************

    COL             IPINEPYQGIDLSNESFDFEMLRQMLGKHFISQDIVTKDAKRLITQLATLYGLTADGMKH
    N315            IPINEPYQGIDLSNESFDFEMLRQMLGKHFISQDIVTKDAKRLITQLATLYGLTADGMKH
    NCTC8325        IPINEPYQGIDLSNESFDFEMLRQMLGKHFISQDIVTKDAKRLITQLATLYGLTADGMKH
    Newman          IPINEPYQGIDLSNESFDFEMLRQMLGKHFISQDIVTKDAKRLITQLATLYGLTADGMKH
    USA300_FPR3757  IPINEPYQGIDLSNESFDFEMLRQMLGKHFISQDIVTKDAKRLITQLATLYGLTADGMKH
                    ************************************************************

    COL             VILNSITSGQQLSFEEMRKQARSYYLMEHENQMPKLQVKSPATSSSAGKSSEVNPKPQSD
    N315            VILNSITSGQQLSFEEMRKQARSYYLMEHENQMPKLQVKSPATSSSTGKSSEVNPKPQSD
    NCTC8325        VILNSITSGQQLSFEEMRKQARSYYLMEHENQMPKLQVKSPATSSSAGKSSEVNPKPQSD
    Newman          VILNSITSGQQLSFEEMRKQARSYYLMEHENQMPKLQVKSPATSSSAGKSSEVNPKPQSD
    USA300_FPR3757  VILNSITSGQQLSFEEMRKQARSYYLMEHENQMPKLQVKSPATSSSAGKSSEVNPKPQSD
                    **********************************************:*************

    COL             EWFELLEQTSPIDMLASWSESEPTISQKTMVEELIEREKMSFGVINILLQFVMLKEDMKL
    N315            EWFELLEQTSPIDMLASWSESEPTISQKTMVEELIEREKMSFGVINILLQFVMLKEDMKL
    NCTC8325        EWFELLEQTSPIDMLASWSESEPTISQKTMVEELIEREKMSFGVINILLQFVMLKEDMKL
    Newman          EWFELLEQTSPIDMLASWSESEPTISQKTMVEELIEREKMSFGVINILLQFVMLKEDMKL
    USA300_FPR3757  EWFELLEQTSPIDMLASWSESEPTISQKTMVEELIEREKMSFGVINILLQFVMLKEDMKL
                    ************************************************************

    COL             PKAYILEIASNWKKKGIKTAKEAYNYAKKVNQPKNEGSSGNYQKRGSYYGQRNRISKEKT
    N315            PKAYILEIASNWKKKGIKTAKEAYNYAKKVNQPKNEGSSGNYQKRGSYYGQRNRISKEKT
    NCTC8325        PKAYILEIASNWKKKGIKTAKEAYNYAKKVNQPKNEGSSGNYQKRGSYYGQRNRISKEKT
    Newman          PKAYILEIASNWKKKGIKTAKEAYNYAKKVNQPKNEGSSGNYQKRGSYYGQRNRISKEKT
    USA300_FPR3757  PKAYILEIASNWKKKGIKTAKEAYNYAKKVNQPKNEGSSGNYQKRGSYYGQRNRISKEKT
                    ************************************************************

    COL             PKWLENRDKPSEEDSAKDNSVDDQQLEQDRQAFLDKLSKKWEEDSQ
    N315            PKWLENRDKPSEEDSAKDNSVDDQQLEQDRQAFLDKLSKKWEEDSR
    NCTC8325        PKWLENRDKPSEEDSAKDNSVDDQQLEQDRQAFLDKLSKKWEEDSQ
    Newman          PKWLENRDKPSEEDSAKDNSVDDQQLEQDRQAFLDKLSKKWEEDSQ
    USA300_FPR3757  PKWLENRDKPSEEDSAKDNSVDDQQLEQDRQAFLDKLSKKWEEDSQ
                    *********************************************: