From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004349000
  • symbol?:
  • description?: NAD-dependent malic enzyme 4

      descriptions from strain specific annotations:

    • NAD-dependent malic enzyme 4
    • NADP-dependent malic enzyme
    • NADP-dependent malic enzyme, malate dehydrogenase
    • putative NADP-dependent malic enzyme
    • malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
    • malate dehydrogenase-like protein
    • malic enzyme, NAD binding domain protein
    • NAD-dependent malic enzyme
    • NAD-dependent malic enzyme (NAD-ME)
    • NADP-dependent malate dehydrogenase (oxaloacetate-decarboxylating)
    • NADP-dependent malic enzyme, putative
  • strand?: -
  • coordinates?: 4588996..4589964
  • synteny block?: BlockID0033540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1596 (maeB)
    USA300_FPR3757:
    04-02981:
    SA2981_1660
    08BA02176:
    C248_1743
    11819-97:
    MS7_1708
    71193:
    ST398NM01_1755
    ECT-R 2:
    ECTR2_1541
    ED133:
    SAOV_1689
    ED98:
    SAAV_1711
    HO 5096 0412:
    SAEMRSA15_16110
    JH1:
    SaurJH1_1792
    JH9:
    SaurJH9_1758
    JKD6008:
    SAA6008_01670 (maeB)
    JKD6159:
    SAA6159_01625 (maeB)
    LGA251:
    SARLGA251_15930
    M013:
    M013TW_1714
    MRSA252:
    SAR1780
    MSHR1132:
    SAMSHR1132_15520
    MSSA476:
    SAS1629
    Mu3:
    SAHV_1688
    Mu50:
    SAV1702
    MW2:
    MW1645
    RF122:
    SAB1560c
    ST398:
    SAPIG1755
    T0131:
    SAT0131_01805 (mnhE)
    TCH60:
    HMPREF0772_11450 (maeB)
    TW20:
    SATW20_16930
    USA300_TCH1516:
    USA300HOU_1688
    VC40:
    SAVC_07720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLRDEALEMHKRNQGKLEVKPNVKVTNKEELSLAYSPGVAEPCKDIYEDKRKVYDYTIK
    N315            MSLRDEALEMHKRNQGKLEVKPNVKVTNKEELSLAYSPGVAEPCKDIYEDKRKVYDYTIK
    NCTC8325        MSLRDEALEMHKRNQGKLEVKPNVKVTNKEELSLAYSPGVAEPCKDIYEDKRKVYDYTIK
    Newman          MSLRDEALEMHKRNQGKLEVKPNVKVTNKEELSLAYSPGVAEPCKDIYEDKRKVYDYTIK
    USA300_FPR3757  MSLRDEALEMHKRNQGKLEVKPNVKVTNKEELSLAYSPGVAEPCKDIYEDKRKVYDYTIK
                    ************************************************************

    COL             GNTVAVITDGTAVLGLGNIGPEASIPVMEGKAVLFKSFAGINGVPIALNTTDTEEIIKTV
    N315            GNTVAVITDGTAVLGLGNIGPEASIPVMEGKAVLFKSFAGINGVPIALNTTDTEEIIKTV
    NCTC8325        GNTVAVITDGTAVLGLGNIGPEASIPVMEGKAVLFKSFAGINGVPIALNTTDTEEIIKTV
    Newman          GNTVAVITDGTAVLGLGNIGPEASIPVMEGKAVLFKSFAGINGVPIALNTTDTEEIIKTV
    USA300_FPR3757  GNTVAVITDGTAVLGLGNIGPEASIPVMEGKAVLFKSFAGINGVPIALNTTDTEEIIKTV
                    ************************************************************

    COL             KLLEPNYGGINLEDISAPRCFEIEERLKKETNIPVFHDDQHGTAIVTLAGLVNALRVVNK
    N315            KLLEPNYGGINLEDISAPRCFEIEERLKKETNIPVFHDDQHGTAIVTMAGLVNALRVVNK
    NCTC8325        KLLEPNYGGINLEDISAPRCFEIEERLKKETNIPVFHDDQHGTAIVTLAGLVNALRVVNK
    Newman          KLLEPNYGGINLEDISAPRCFEIEERLKKETNIPVFHDDQHGTAIVTLAGLVNALRVVNK
    USA300_FPR3757  KLLEPNYGGINLEDISAPRCFEIEERLKKETNIPVFHDDQHGTAIVTLAGLVNALRVVNK
                    ***********************************************:************

    COL             DIAKIKVVLNGAGAAGIAIVKLLYAYGVRNMVMCDSRGAIFEGRSYGMNPTKDVVAKWTN
    N315            DIAKIKVVLNGAGAAGIAIVKLLYAYGVRNMVMCDSRGAIFEGRSYGMNPTKDVVAKWTN
    NCTC8325        DIAKIKVVLNGAGAAGIAIVKLLYAYGVRNMVMCDSRGAIFEGRSYGMNPTKDVVAKWTN
    Newman          DIAKIKVVLNGAGAAGIAIVKLLYAYGVRNMVMCDSRGAIFEGRSYGMNPTKDVVAKWTN
    USA300_FPR3757  DIAKIKVVLNGAGAAGIAIVKLLYAYGVRNMVMCDSRGAIFEGRSYGMNPTKDVVAKWTN
                    ************************************************************

    COL             KDKIEGSLEEVVKDADVFIGVSVANALSQDMVKSMADNPIIFAMANPNPEIIPDDAKAAG
    N315            KDKIEGSLEEVVKDADVFIGVSVANALSQDMVKSMADNPIIFAMANPNPEIIPDDAKAAG
    NCTC8325        KDKIEGSLEEVVKDADVFIGVSVANALSQDMVKSMADNPIIFAMANPNPEIIPDDAKAAG
    Newman          KDKIEGSLEEVVKDADVFIGVSVANALSQDMVKSMADNPIIFAMANPNPEIIPDDAKAAG
    USA300_FPR3757  KDKIEGSLEEVVKDADVFIGVSVANALSQDMVKSMADNPIIFAMANPNPEIIPDDAKAAG
                    ************************************************************

    COL             ARVVGTGRSDYPNQINNVLAFPGIFRGALEVEATHINEEMKKAAVEAIADLIDSSELNED
    N315            ARVVGTGRSDYPNQINNVLAFPGIFRGALEVEATHINEEMKKAAVEAIADLIDSSELNED
    NCTC8325        ARVVGTGRSDYPNQINNVLAFPGIFRGALEVEATHINEEMKKAAVEAIADLIDSSELNED
    Newman          ARVVGTGRSDYPNQINNVLAFPGIFRGALEVEATHINEEMKKAAVEAIADLIDSSELNED
    USA300_FPR3757  ARVVGTGRSDYPNQINNVLAFPGIFRGALEVEATHINEEMKKAAVEAIADLIDSSELNED
                    ************************************************************

    COL             YCIPGPFDKRVAPSVARNVAKAAMESGVARIEVDPQDVYDKTMKLTDLQ
    N315            YCIPGPFDKRVAPSVARNVAKAAMESGVARIEVDPQDVYDKTMKLTDLQ
    NCTC8325        YCIPGPFDKRVAPSVARNVAKAAMESGVARIEVDPQDVYDKTMKLTDLQ
    Newman          YCIPGPFDKRVAPSVARNVAKAAMESGVARIEVDPQDVYDKTMKLTDLQ
    USA300_FPR3757  YCIPGPFDKRVAPSVARNVAKAAMESGVARIEVDPQDVYDKTMKLTDLQ
                    *************************************************