From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004354000
  • symbol?:
  • description?: CBS domain-containing protein

      descriptions from strain specific annotations:

    • CBS domain-containing protein
    • CBS domain protein
    • Cytosolic protein containing multiple CBS domains
    • DRTGG domain-containing protein
    • pseudogene
    • putative DNA-binding protein
    • thioesterase family protein
    • thioesterase superfamily protein
    • transcriptional regulator
  • strand?: -
  • coordinates?: 4595754..4597052
  • synteny block?: BlockID0033590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1663
    08BA02176:
    C248_1746
    11819-97:
    MS7_1711
    71193:
    ST398NM01_1758
    ECT-R 2:
    ECTR2_1545
    ED133:
    SAOV_1692
    ED98:
    SAAV_1714
    HO 5096 0412:
    SAEMRSA15_16140
    JH1:
    SaurJH1_1795
    JH9:
    SaurJH9_1761
    JKD6008:
    SAA6008_01673
    JKD6159:
    SAA6159_01628
    LGA251:
    SARLGA251_15960
    M013:
    M013TW_1717
    MRSA252:
    SAR1783
    MSHR1132:
    SAMSHR1132_15550
    MSSA476:
    SAS1632
    Mu3:
    SAHV_1691
    Mu50:
    SAV1705
    MW2:
    MW1648
    RF122:
    SAB1563c
    ST398:
    SAPIG1758
    T0131:
    SAT0131_01808
    TCH60:
    HMPREF0772_11447
    TW20:
    SATW20_16960
    USA300_TCH1516:
    USA300HOU_1691
    VC40:
    SAVC_07735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKHEQILDYIESLSIGSKISVRKIAKFLNVSEGTAYRAIKDADKMGMVATIDRVGTVRI
    N315            MTKHEQILDYIESLSIGSKISVRKIAKFLNVSEGTAYRAIKDADKMGMVATIDRVGTVRI
    NCTC8325        MTKHEQILDYIESLSIGSKISVRKIAKFLNVSEGTAYRAIKDADKMGMVATIDRVGTVRI
    Newman          MTKHEQILDYIESLSIGSKISVRKIAKFLNVSEGTAYRAIKDADKMGMVATIDRVGTVRI
    USA300_FPR3757  MTKHEQILDYIESLSIGSKISVRKIAKFLNVSEGTAYRAIKDADKMGMVATIDRVGTVRI
                    ************************************************************

    COL             EKRNRNEIEHLTFNEIVNIIDGQVLGGNKGITKMVSKFAIGAMELKDILKYIGPKTLLIV
    N315            EKRNRNEIEHLTFNEIVNIIDGQVLGGNKGITKMVSKFAIGAMELKDILKYIGPKTLLIV
    NCTC8325        EKRNRNEIEHLTFNEIVNIIDGQVLGGNKGITKMVSKFAIGAMELKDILKYIGPKTLLIV
    Newman          EKRNRNEIEHLTFNEIVNIIDGQVLGGNKGITKMVSKFAIGAMELKDILKYIGPKTLLIV
    USA300_FPR3757  EKRNRNEIEHLTFNEIVNIIDGQVLGGNKGITKMVSKFAIGAMELKDILKYIGPKTLLIV
                    ************************************************************

    COL             GNREDVQIEALKRGTAILITGGFKPSNKVINFANEHDLPVLSSSYDTFLVANIINKALFN
    N315            GNREDVQIEALKRGTAILITGGFKPSNKVINFANEHDLPVLSSSYDTFLVANIINKALFN
    NCTC8325        GNREDVQIEALKRGTAILITGGFKPSNKVINFANEHDLPVLSSSYDTFLVANIINKALFN
    Newman          GNREDVQIEALKRGTAILITGGFKPSNKVINFANEHDLPVLSSSYDTFLVANIINKALFN
    USA300_FPR3757  GNREDVQIEALKRGTAILITGGFKPSNKVINFANEHDLPVLSSSYDTFLVANIINKALFN
                    ************************************************************

    COL             QKIRKDILIVQDIMTPLDDLSVLFDTMKIADYKRMANRTGHTRFPVVNESYKLVGIVTSR
    N315            QKIRKDILIVQDIMTPLDDLSVLFDTMKIADYKRMANRTGHTRFPVVNESYKLVGIVTSR
    NCTC8325        QKIRKDILIVQDIMTPLDDLSVLFDTMKIADYKRMANRTGHTRFPVVNESYKLVGIVTSR
    Newman          QKIRKDILIVQDIMTPLDDLSVLFDTMKIADYKRMANRTGHTRFPVVNESYKLVGIVTSR
    USA300_FPR3757  QKIRKDILIVQDIMTPLDDLSVLFDTMKIADYKRMANRTGHTRFPVVNESYKLVGIVTSR
                    ************************************************************

    COL             EMINTKDDDEIDKVMTRNPIYVNAMSTVASCAHMMIWEGIELIPVVSSNKKTVGVINRQD
    N315            EMINTKDDDEIDKVMTRNPIYVNAMSTVASCAHMMIWEGIELIPVVSSNKKTVGVINRQD
    NCTC8325        EMINTKDDDEIDKVMTRNPIYVNAMSTVASCAHMMIWEGIELIPVVSSNKKTVGVINRQD
    Newman          EMINTKDDDEIDKVMTRNPIYVNAMSTVASCAHMMIWEGIELIPVVSSNKKTVGVINRQD
    USA300_FPR3757  EMINTKDDDEIDKVMTRNPIYVNAMSTVASCAHMMIWEGIELIPVVSSNKKTVGVINRQD
                    ************************************************************

    COL             VLKSMQLLGRQPQMGETINDQIAKYITMNQDGITVEVSPLLINHYGTVSKAAFVSIIEET
    N315            VLKSMQLLGRQPQMGETINDQIAKYITMNQDGITVEVSPLLINHYGTVSKAAFVSIIEET
    NCTC8325        VLKSMQLLGRQPQMGETINDQIAKYITMNQDGITVEVSPLLINHYGTVSKAAFVSIIEET
    Newman          VLKSMQLLGRQPQMGETINDQIAKYITMNQDGITVEVSPLLINHYGTVSKAAFVSIIEET
    USA300_FPR3757  VLKSMQLLGRQPQMGETINDQIAKYITMNQDGITVEVSPLLINHYGTVSKAAFVSIIEET
                    ************************************************************

    COL             IQYEMRKFKKGNVMIENLNIVYIKTVPIESHITVRFGILDVGRNFAKIEVNMHSQNDKVA
    N315            IQYEMRKFKKGNVMIENLNIVYIKTVPIESHITVRFGILDVGRNFAKIEVNMHSQNDKVA
    NCTC8325        IQYEMRKFKKGNVMIENLNIVYIKTVPIESHITVRFGILDVGRNFAKIEVNMHSQNDKVA
    Newman          IQYEMRKFKKGNVMIENLNIVYIKTVPIESHITVRFGILDVGRNFAKIEVNMHSQNDKVA
    USA300_FPR3757  IQYEMRKFKKGNVMIENLNIVYIKTVPIESHITVRFGILDVGRNFAKIEVNMHSQNDKVA
                    ************************************************************

    COL             SALVICQMFDEV
    N315            SALVICQMFDEV
    NCTC8325        SALVICQMFDEV
    Newman          SALVICQMFDEV
    USA300_FPR3757  SALVICQMFDEV
                    ************