From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004364000
  • symbol?:
  • description?: Adenine-specific methyltransferase

      descriptions from strain specific annotations:

    • Adenine-specific methyltransferase
    • adenine-specific DNA methylase-like protein
    • methyltransferase small domain-containing protein
    • Site-specific DNA-methyltransferase (Adenine-specific)
  • strand?: -
  • coordinates?: 4604144..4605091
  • synteny block?: BlockID0033690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1670
    08BA02176:
    C248_1753
    11819-97:
    MS7_1718
    71193:
    ST398NM01_1765
    ECT-R 2:
    ECTR2_1552
    ED133:
    SAOV_1699
    ED98:
    SAAV_1722
    HO 5096 0412:
    SAEMRSA15_16210
    JH1:
    SaurJH1_1803
    JH9:
    SaurJH9_1768
    JKD6008:
    SAA6008_01680
    JKD6159:
    SAA6159_01636
    LGA251:
    SARLGA251_16030
    M013:
    M013TW_1725
    MRSA252:
    SAR1790
    MSHR1132:
    SAMSHR1132_15620
    MSSA476:
    SAS1639
    Mu3:
    SAHV_1698
    Mu50:
    SAV1712
    MW2:
    MW1655
    RF122:
    SAB1571c
    ST398:
    SAPIG1765
    T0131:
    SAT0131_01815 (sirR)
    TCH60:
    HMPREF0772_11440
    TW20:
    SATW20_17030
    USA300_TCH1516:
    USA300HOU_1699
    VC40:
    SAVC_07770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAEQQTIMERLFHTLDEKAKTLNNENGQSFIENLGLAMEQVYTNERGLLEQSTLQDRRKA
    N315            MAEQQTIMERLFHTLDEKAKTLNNENGQSFIENLGLAMEQVYTNERGLLEQSTLQDRRKA
    NCTC8325        MAEQQTIMERLFHTLDEKAKTLNNENGQSFIENLGLAMEQVYTNERGLLEQSTLQDRRKA
    Newman          MAEQQTIMERLFHTLDEKAKTLNNENGQSFIENLGLAMEQVYTNERGLLEQSTLQDRRKA
    USA300_FPR3757  MAEQQTIMERLFHTLDEKAKTLNNENGQSFIENLGLAMEQVYTNERGLLEQSTLQDRRKA
                    ************************************************************

    COL             FQFAYLSLMQEEKIQANHQITPDSIGLILGFLVERFMNNQEELHIVDIASGAGHLSATVK
    N315            FQFAYLSLMQEEKIQANHQITPDSIGLILGFLVERFMNNQEELHIVDIASGAGHLSATVK
    NCTC8325        FQFAYLSLMQEEKIQANHQITPDSIGLILGFLVERFMNNQEELHIVDIASGAGHLSATVK
    Newman          FQFAYLSLMQEEKIQANHQITPDSIGLILGFLVERFMNNQEELHIVDIASGAGHLSATVK
    USA300_FPR3757  FQFAYLSLMQEEKIQANHQITPDSIGLILGFLVERFMNNQEELHIVDIASGAGHLSATVK
                    ************************************************************

    COL             EVLPEIAVMHHLIEVDPVLSRVSVHLANFLEIPFDVYPQDAIMPLPLEEADIVIGDFPVG
    N315            EVLPEIAVMHHLIEVDPVLSRVSVHLANFLEIPFDVYPQDAIMPLPLEEADIVIGDFPVG
    NCTC8325        EVLPEIAVMHHLIEVDPVLSRVSVHLANFLEIPFDVYPQDAIMPLPLEEADIVIGDFPVG
    Newman          EVLPEIAVMHHLIEVDPVLSRVSVHLANFLEIPFDVYPQDAIMPLPLEEADIVIGDFPVG
    USA300_FPR3757  EVLPEIAVMHHLIEVDPVLSRVSVHLANFLEIPFDVYPQDAIMPLPLEEADIVIGDFPVG
                    ************************************************************

    COL             YYPIDERSKEFKLGFEEGHSYSHYLLIEQAINALKDAGYAFLVVPSNIFTGEHVKQLEKY
    N315            YYPIDERSKEFKLGFEEGHSYSHYLLIEQAINALKDAGYAFLVVPSNIFTGEHVKQLEKY
    NCTC8325        YYPIDERSKEFKLGFEEGHSYSHYLLIEQAINALKDAGYAFLVVPSNIFTGEHVKQLEKY
    Newman          YYPIDERSKEFKLGFEEGHSYSHYLLIEQAINALKDAGYAFLVVPSNIFTGEHVKQLEKY
    USA300_FPR3757  YYPIDERSKEFKLGFEEGHSYSHYLLIEQAINALKDAGYAFLVVPSNIFTGEHVKQLEKY
                    ************************************************************

    COL             IATETEMQAFLNLPPTLFKNEKARKSILILQKKKSGETKPVEVLLANIPDFKIPSQFQGF
    N315            IATETEMQAFLNLPPTLFKNEKARKSILILQKKKSGETKPVEVLLANIPDFKNPSQFQGF
    NCTC8325        IATETEMQAFLNLPPTLFKNEKARKSILILQKKKSGETKPVEVLLANIPDFKIPSQFQGF
    Newman          IATETEMQAFLNLPPTLFKNEKARKSILILQKKKSGETKPVEVLLANIPDFKIPSQFQGF
    USA300_FPR3757  IATETEMQAFLNLPPTLFKNEKARKSILILQKKKSGETKPVEVLLANIPDFKIPSQFQGF
                    **************************************************** *******

    COL             MTELNQWMDTNRPKK
    N315            MTELNQWMDTNRPKK
    NCTC8325        MTELNQWMDTNRPKK
    Newman          MTELNQWMDTNRPKK
    USA300_FPR3757  MTELNQWMDTNRPKK
                    ***************