From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004368000
  • symbol?: nifZ
  • description?: cysteine desulfurase

      descriptions from strain specific annotations:

    • cysteine desulfurase
    • aminotransferase, class V
    • class V aminotransferase
    • Aminotransferase class V
    • aminotransferase class-V family protein
    • aminotransferase class-V protein
    • iron-sulfur cofactor synthesis protein nifZ
    • Selenocysteine lyase
  • strand?: -
  • coordinates?: 4607847..4608986
  • synteny block?: BlockID0033730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1674 (nifZ)
    08BA02176:
    C248_1757
    11819-97:
    MS7_1722
    71193:
    ST398NM01_1769
    ECT-R 2:
    ECTR2_1556
    ED133:
    SAOV_1703
    ED98:
    SAAV_1726
    HO 5096 0412:
    SAEMRSA15_16250
    JH1:
    SaurJH1_1807
    JH9:
    SaurJH9_1772
    JKD6008:
    SAA6008_01684
    JKD6159:
    SAA6159_01640
    LGA251:
    SARLGA251_16070
    M013:
    M013TW_1729
    MRSA252:
    SAR1794
    MSHR1132:
    SAMSHR1132_15660
    MSSA476:
    SAS1643
    Mu3:
    SAHV_1702
    Mu50:
    SAV1716
    MW2:
    MW1659
    RF122:
    SAB1575c
    ST398:
    SAPIG1769
    T0131:
    SAT0131_01819
    TCH60:
    HMPREF0772_11436 (iscS)
    TW20:
    SATW20_17070
    USA300_TCH1516:
    USA300HOU_1703 (csd2)
    VC40:
    SAVC_07790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMIN
    N315            ---MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKAQINAMIN
    NCTC8325        MFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMIN
    Newman          ---MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMIN
    USA300_FPR3757  ---MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMIN
                       :************************************************:*******

    COL             SKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKV
    N315            SKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKV
    NCTC8325        SKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKV
    Newman          SKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKV
    USA300_FPR3757  SKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKV
                    ************************************************************

    COL             KYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVD
    N315            KYVDVKKDGSINLEHFKELVSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVD
    NCTC8325        KYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVD
    Newman          KYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVD
    USA300_FPR3757  KYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVD
                    *******************:****************************************

    COL             AVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTV
    N315            AVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTV
    NCTC8325        AVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTV
    Newman          AVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTV
    USA300_FPR3757  AVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTV
                    ************************************************************

    COL             NLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISF
    N315            NLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISF
    NCTC8325        NLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISF
    Newman          NLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISF
    USA300_FPR3757  NLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISF
                    ************************************************************

    COL             PGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTK
    N315            PGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTK
    NCTC8325        PGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTK
    Newman          PGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTK
    USA300_FPR3757  PGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTK
                    ************************************************************

    COL             EDIARFKEIFIIIYEEIKELLK
    N315            EDIARFKEIFIIIYEEIKELLK
    NCTC8325        EDIARFKEIFIIIYEEIKELLK
    Newman          EDIARFKEIFIIIYEEIKELLK
    USA300_FPR3757  EDIARFKEIFIIIYEEIKELLK
                    **********************