From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004370000
  • symbol?: ezrA
  • description?: septation ring formation regulator EzrA

      descriptions from strain specific annotations:

    • septation ring formation regulator EzrA
    • septation ring formation regulator, EzrA family protein
    • putative septation ring formation regulator
  • strand?: -
  • coordinates?: 4609571..4611265
  • synteny block?: BlockID0033750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1611 (ezrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1676 (ezrA)
    08BA02176:
    C248_1758
    11819-97:
    MS7_1724 (ezrA)
    71193:
    ST398NM01_1770
    ECT-R 2:
    ECTR2_1558
    ED133:
    SAOV_1704
    ED98:
    SAAV_1728
    HO 5096 0412:
    SAEMRSA15_16260
    JH1:
    SaurJH1_1808
    JH9:
    SaurJH9_1773
    JKD6008:
    SAA6008_01686 (ezrA)
    JKD6159:
    SAA6159_01641 (ezrA)
    LGA251:
    SARLGA251_16080
    M013:
    M013TW_1730
    MRSA252:
    SAR1795
    MSHR1132:
    SAMSHR1132_15670
    MSSA476:
    SAS1644
    Mu3:
    SAHV_1703
    Mu50:
    SAV1717
    MW2:
    MW1660
    RF122:
    SAB1576c
    ST398:
    SAPIG1770 (ezrA)
    T0131:
    SAT0131_01821 (tagB)
    TCH60:
    HMPREF0772_11435 (ezrA)
    TW20:
    SATW20_17080
    USA300_TCH1516:
    USA300HOU_1705 (ezrA)
    VC40:
    SAVC_07795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVLYIILAIIVIILIAVGVLFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKG
    N315            MVLYIILAIIVIILIAVGVLFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKG
    NCTC8325        MVLYIILAIIVIILIAVGVLFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKG
    Newman          MVLYIILAIIVIILIAVGVLFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKG
    USA300_FPR3757  MVLYIILAIIVIILIAVGVLFYLRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKG
                    ************************************************************

    COL             ETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNASQSEIDDANELMDSYEQS
    N315            ETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNASQSEIDDANELMDSYEQS
    NCTC8325        ETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNASQSEIDDANELMDSYEQS
    Newman          ETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNASQSEIDDANELMDSYEQS
    USA300_FPR3757  ETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNASQSEIDDANELMDSYEQS
                    ************************************************************

    COL             YQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPR
    N315            YQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPR
    NCTC8325        YQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPR
    Newman          YQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPR
    USA300_FPR3757  YQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPR
                    ************************************************************

    COL             LEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCR
    N315            LEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCR
    NCTC8325        LEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCR
    Newman          LEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCR
    USA300_FPR3757  LEQYEVLKADGNYVQAHNHIAALNEQMKQLRSYMEEIPELIRETQKELPGQFQDLKYGCR
                    ************************************************************

    COL             DLKVEGYDLDHVKVDSTLQSLKTELSFVEPLISRLELEEANDKLANINDKLDDMYDLIEH
    N315            DLKVEGYDLDHVKVDSTLQSLKTELSFVEPLISRLELEEANDKLANINDKLDDMYDLIEH
    NCTC8325        DLKVEGYDLDHVKVDSTLQSLKTELSFVEPLISRLELEEANDKLANINDKLDDMYDLIEH
    Newman          DLKVEGYDLDHVKVDSTLQSLKTELSFVEPLISRLELEEANDKLANINDKLDDMYDLIEH
    USA300_FPR3757  DLKVEGYDLDHVKVDSTLQSLKTELSFVEPLISRLELEEANDKLANINDKLDDMYDLIEH
                    ************************************************************

    COL             EVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVRENYYINESDAQSVRQFENEIQSL
    N315            EVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVRENYYINESDAQSVRQFENEIQSL
    NCTC8325        EVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVRENYYINESDAQSVRQFENEIQSL
    Newman          EVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVRENYYINESDAQSVRQFENEIQSL
    USA300_FPR3757  EVKAKNDVEETKDIITDNLFKAKDMNYTLQTEIEYVRENYYINESDAQSVRQFENEIQSL
                    ************************************************************

    COL             ISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAEDNL
    N315            ISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAEDNL
    NCTC8325        ISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAEDNL
    Newman          ISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAEDNL
    USA300_FPR3757  ISVYDDILKEMSKSAVRYSEVQDNLQYLEDHVTVINDKQEKLQNHLIQLREDEAEAEDNL
                    ************************************************************

    COL             LRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSK
    N315            LRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSK
    NCTC8325        LRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSK
    Newman          LRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSK
    USA300_FPR3757  LRVQSKKEEVYRRLLASNLTSVPERFIIMKNEIDHEVRDVNEQFSERPIHVKQLKDKVSK
                    ************************************************************

    COL             IVIQMNTFEDEANDVLVNAVYAEKLIQYGNRYRKDYSNVDKSLNEAERLFKNNRYKRAIE
    N315            IVIQMNTFEDEANDVLVNAVYAEKLIQYGNRYRKDYSNVDKSLNEAERLFKNNRYKRAIE
    NCTC8325        IVIQMNTFEDEANDVLVNAVYAEKLIQYGNRYRKDYSNVDKSLNEAERLFKNNRYKRAIE
    Newman          IVIQMNTFEDEANDVLVNAVYAEKLIQYGNRYRKDYSNVDKSLNEAERLFKNNRYKRAIE
    USA300_FPR3757  IVIQMNTFEDEANDVLVNAVYAEKLIQYGNRYRKDYSNVDKSLNEAERLFKNNRYKRAIE
                    ************************************************************

    COL             IAEQALESVEPGVTKHIEEEVIKQ
    N315            IAEQVLESVEPGVTKHIEEEVIKQ
    NCTC8325        IAEQALESVEPGVTKHIEEEVIKQ
    Newman          IAEQALESVEPGVTKHIEEEVIKQ
    USA300_FPR3757  IAEQALESVEPGVTKHIEEEVIKQ
                    ****.*******************