From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004378000
  • symbol?:
  • description?: alanine--glyoxylate aminotransferase family protein

      descriptions from strain specific annotations:

    • alanine--glyoxylate aminotransferase family protein
    • aminotransferase, class V
    • class V aminotransferase
    • Phosphoserine aminotransferase, putative
    • aminotransferase class-V family protein
    • putative soluble hydrogenase subunit
    • Serine-pyruvate aminotransferase
    • soluble hydrogenase, small subunit (Tritium exchangesubunit)
    • transaminase
  • strand?: +
  • coordinates?: 4617203..4618363
  • synteny block?: BlockID0033830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1681
    08BA02176:
    C248_1763
    11819-97:
    MS7_1729
    71193:
    ST398NM01_1775
    ECT-R 2:
    ECTR2_1563
    ED133:
    SAOV_1709
    ED98:
    SAAV_1733
    HO 5096 0412:
    SAEMRSA15_16310
    JH1:
    SaurJH1_1813
    JH9:
    SaurJH9_1778
    JKD6008:
    SAA6008_01691
    JKD6159:
    SAA6159_01646
    LGA251:
    SARLGA251_16130
    M013:
    M013TW_1735
    MRSA252:
    SAR1800
    MSHR1132:
    SAMSHR1132_15730
    MSSA476:
    SAS1649
    Mu3:
    SAHV_1709
    Mu50:
    SAV1723
    MW2:
    MW1665
    RF122:
    SAB1581
    ST398:
    SAPIG1775
    T0131:
    SAT0131_01826
    TCH60:
    HMPREF0772_11430
    TW20:
    SATW20_17130
    USA300_TCH1516:
    USA300HOU_1711
    VC40:
    SAVC_07820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYYHQPLLLTPGPTPVPDAIMREIQAPMVGHRSKDFEDIAQQAFQGLKPIFGSQNDVLIL
    N315            MYYHQPLLLTPGPTPVPDAIMREIQAPMVGHRSKDFEDIAQQAFQGLKPIFGSQNDVLIL
    NCTC8325        MYYHQPLLLTPGPTPVPDAIMREIQAPMVGHRSKDFEDIAQQAFQGLKPIFGSQNDVLIL
    Newman          MYYHQPLLLTPGPTPVPDAIMREIQAPMVGHRSKDFEDIAQQAFQGLKPIFGSQNDVLIL
    USA300_FPR3757  MYYHQPLLLTPGPTPVPDAIMREIQAPMVGHRSKDFEDIAQQAFQGLKPIFGSQNDVLIL
                    ************************************************************

    COL             TSSGTSVLEASMLNIVNPEDHFVVIVSGAFGNRFKQIAQTYYKNVHIYDVTWGEAVDVKD
    N315            TSSGTSVLEASMLNIVNPEDHFVVIVSGAFGNRFKQIAQTYYKNVHIYDVTWGEAVDVKD
    NCTC8325        TSSGTSVLEASMLNIVNPEDHFVVIVSGAFGNRFKQIAQTYYKNVHIYDVTWGEAVDVKD
    Newman          TSSGTSVLEASMLNIVNPEDHFVVIVSGAFGNRFKQIAQTYYKNVHIYDVTWGEAVDVKD
    USA300_FPR3757  TSSGTSVLEASMLNIVNPEDHFVVIVSGAFGNRFKQIAQTYYKNVHIYDVTWGEAVDVKD
                    ************************************************************

    COL             FINFLSTLNVEVKAVFSQYCETSTTVLHPIHELGNAINQFNSNIYFVVDGVSCIGAVDVD
    N315            FINYLSTLDVEVKAVFSQYCETSTTVLHPIHELGNAINQFNSNIYFVVDGVSCIGAVDVD
    NCTC8325        FINFLSTLNVEVKAVFSQYCETSTTVLHPIHELGNAINQFNSNIYFVVDGVSCIGAVDVD
    Newman          FINFLSTLNVEVKAVFSQYCETSTTVLHPIHELGNAINQFNSNIYFVVDGVSCIGAVDVD
    USA300_FPR3757  FINFLSTLNVEVKAVFSQYCETSTTVLHPIHELGNAINQFNSNIYFVVDGVSCIGAVDVD
                    ***:****:***************************************************

    COL             INKDKIDVLVSGSQKAIMLPPGLAFVAYSHRAKEHFKEVTTPKFYLDLNKYISSQADNST
    N315            INKDKIDVLVSGSQKAIMLPPGLAFVAYSHRAKERFKEVTTPKFYLDLNKYISSQADNST
    NCTC8325        INKDKIDVLVSGSQKAIMLPPGLAFVAYSHRAKEHFKEVTTPKFYLDLNKYISSQADNST
    Newman          INKDKIDVLVSGSQKAIMLPPGLAFVAYSHRAKEHFKEVTTPKFYLDLNKYISSQADNST
    USA300_FPR3757  INKDKIDVLVSGSQKAIMLPPGLAFVAYSHRAKEHFKEVTTPKFYLDLNKYISSQADNST
                    **********************************:*************************

    COL             PFTPNVSLFRGVNAYVETVKAEGFNHVIARHYAIRNALRSALKALDLTLLVNDKDASPTV
    N315            PFTPNVSLFRGVNAYVETVKAEGFNHVIARHYAIRNALRSALKALDLTLLVNDKDASPTV
    NCTC8325        PFTPNVSLFRGVNAYVETVKAEGFNHVIARHYAIRNALRSALKALDLTLLVNDKDASPTV
    Newman          PFTPNVSLFRGVNAYVETVKAEGFNHVIARHYAIRNALRSALKALDLTLLVNDKDASPTV
    USA300_FPR3757  PFTPNVSLFRGVNAYVETVKAEGFNHVIARHYAIRNALRSALKALDLTLLVNDKDASPTV
                    ************************************************************

    COL             TAFKPNTNDEVKIIKDELKNRFKITIAGGQGHLKGQILRIGHMGKISPFDILSVVSALEI
    N315            TAFKPNTN-EVKIIKDELKNRFKITIAGGQGHLKGQILRIGHMGKISPFDILSVVSALEI
    NCTC8325        TAFKPNTNDEVKIIKDELKNRFKITIAGGQGHLKGQILRIGHMGKISPFDILSVVSALEI
    Newman          TAFKPNTNDEVKIIKDELKNRFKITIAGGQGHLKGQILRIGHMGKISPFDILSVVSALEI
    USA300_FPR3757  TAFKPNTNDEVKIIKDELKNRFKITIAGGQGHLKGQILRIGHMGKISPFDILSVVSALEI
                    ******** ***************************************************

    COL             ILTEHRKVNYIGKGISKYMEVIHEAI
    N315            ILTEHRKVNYIGKGISKYMEVIHEAI
    NCTC8325        ILTEHRKVNYIGKGISKYMEVIHEAI
    Newman          ILTEHRKVNYIGKGISKYMEVIHEAI
    USA300_FPR3757  ILTEHRKVNYIGKGISKYMEVIHEAI
                    **************************