From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004386000
  • symbol?:
  • description?: acylglycerol-3-phosphate O-acyltransferase

      descriptions from strain specific annotations:

    • acylglycerol-3-phosphate O-acyltransferase
    • 1-acyl-sn-glycerol-3-phosphate acyltransferase
    • 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
    • 1-acylglycerol-3-phosphate O-acyltransferases domain protein
    • putative acyltransferase
    • 1-acyl-sn-glycerol-3-phosphate acyltransferases
    • 1-acyl-sn-glycerol-3-phosphate acyltransferase domain-containing protein
    • acyltransferase family protein
  • strand?: -
  • coordinates?: 4625017..4625625
  • synteny block?: BlockID0033900
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1620 (plsC)
    USA300_FPR3757:
    04-02981:
    SA2981_1685
    08BA02176:
    C248_1769
    11819-97:
    MS7_1733
    71193:
    ST398NM01_1779
    ECT-R 2:
    ECTR2_1567
    ED133:
    SAOV_1713
    ED98:
    SAAV_1737
    HO 5096 0412:
    SAEMRSA15_16350
    JH1:
    SaurJH1_1817
    JH9:
    SaurJH9_1782
    JKD6008:
    SAA6008_01695 (plsC)
    JKD6159:
    SAA6159_01650 (plsC)
    LGA251:
    SARLGA251_16170
    M013:
    M013TW_1741
    MRSA252:
    SAR1804
    MSHR1132:
    SAMSHR1132_15770
    MSSA476:
    SAS1653
    Mu3:
    SAHV_1713
    Mu50:
    SAV1727
    MW2:
    MW1669
    RF122:
    SAB1585c
    ST398:
    SAPIG1779
    T0131:
    SAT0131_01830 (abcA)
    TCH60:
    HMPREF0772_11426 (plsC)
    TW20:
    SATW20_17170
    USA300_TCH1516:
    VC40:
    SAVC_07840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYSVISKILNFILVKMSKSLYVIGKDNIPKDSKYVVTCTHESYNEVIMLGMALYPNQIHY
    N315            MYSVISKILNFILVKMSKSLYVIGKDNIPKDSKYVVTCTHESYNEVIMLGMALYPNQIHY
    NCTC8325        MYSVISKILNFILVKMSKSLYVIGKDNIPKDSKYVVTCTHESYNEVIMLGMALYPNQIHY
    Newman          MYSVISKILNFILVKMSKSLYVIGKDNIPKDSKYVVTCTHESYNEVIMLGMALYPNQIHY
    USA300_FPR3757  MYSVISKILNFILVKMSKSLYVIGKDNIPKDSKYVVTCTHESYNEVIMLGMALYPNQIHY
                    ************************************************************

    COL             MAKKELFKNKWIGKFLTSLNAFPVDRENPGPSTLKRPINLLKDNKTVGIFPTGSRTSQEG
    N315            MAKKELFKNKWIGKFLTSLNAFPVDRENPGPSTLKRPINLLKDNKTVGIFPTGSRTSQEG
    NCTC8325        MAKKELFKNKWIGKFLTSLNAFPVDRENPGPSTLKRPINLLKDNKTVGIFPTGSRTSQEG
    Newman          MAKKELFKNKWIGKFLTSLNAFPVDRENPGPSTLKRPINLLKDNKTVGIFPTGSRTSQEG
    USA300_FPR3757  MAKKELFKNKWIGKFLTSLNAFPVDRENPGPSTLKRPINLLKDNKTVGIFPTGSRTSQEG
                    ************************************************************

    COL             APLKRGASTIAMLSKSPILPVAYVGPTKIHGLLTGQAYINIGKPIDINDLPKDLKRNERI
    N315            APLKRGASTIAMLSKSPILPVAYVGPTKIHGLLTGQAYINIGKPIDINDLPKDLKRNERI
    NCTC8325        APLKRGASTIAMLSKSPILPVAYVGPTKIHGLLTGQAYINIGKPIDINDLPKDLKRNERI
    Newman          APLKRGASTIAMLSKSPILPVAYVGPTKIHGLLTGQAYINIGKPIDINDLPKDLKRNERI
    USA300_FPR3757  APLKRGASTIAMLSKSPILPVAYVGPTKIHGLLTGQAYINIGKPIDINDLPKDLKRNERI
                    ************************************************************

    COL             DYITKEIETRTAKLQQELHEIVKSL
    N315            DYITKEIETRTAKLQQELHEIVKSL
    NCTC8325        DYITKEIETRTAKLQQELHEIVKSL
    Newman          DYITKEIETRTAKLQQELHEIVKSL
    USA300_FPR3757  DYITKEIETRTAKLQQELHEIVKSL
                    *************************