From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004387000
  • symbol?: htrA1
  • description?: serine proteinase Do

      descriptions from strain specific annotations:

    • serine proteinase Do
    • serine protease HtrA
    • putative serine protease HtrA
    • 2-alkenal reductase
    • peptidase
    • serine protease HtrA, putative
    • putative protease
    • Serine protease, DegP/HtrA, do-like protein
    • Trypsin-like serine endoprotease
    • putative serine protease do-like htrA
    • trypsin family protein
    • S1 family peptidase
    • trypsin domain protein
  • strand?: +
  • coordinates?: 4625806..4627080
  • synteny block?: BlockID0033910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1686 (degP)
    08BA02176:
    C248_1770
    11819-97:
    MS7_1734
    71193:
    ST398NM01_1780
    ECT-R 2:
    ECTR2_1568
    ED133:
    SAOV_1714
    ED98:
    SAAV_1738
    HO 5096 0412:
    SAEMRSA15_16360
    JH1:
    SaurJH1_1818
    JH9:
    SaurJH9_1783
    JKD6008:
    SAA6008_01696
    JKD6159:
    SAA6159_01651
    LGA251:
    SARLGA251_16180 (htrA1)
    M013:
    M013TW_1742
    MRSA252:
    SAR1805
    MSHR1132:
    SAMSHR1132_15780
    MSSA476:
    SAS1654
    Mu3:
    SAHV_1714
    Mu50:
    SAV1728
    MW2:
    MW1670
    RF122:
    SAB1586
    ST398:
    SAPIG1780
    T0131:
    SAT0131_01831
    TCH60:
    HMPREF0772_11425
    TW20:
    SATW20_17180 (htrA1)
    USA300_TCH1516:
    USA300HOU_1716
    VC40:
    SAVC_07845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDFNHTDHSTTNHSQTPRYRRPKFPWFKTVIVALIAGIIGALLVLGIGKVLNSTILNKD
    N315            MSDFNHTDHSTTNHSQTPRYRRPKFPWFKTVIVALIAGIIGALLVLGIGKVLNSTILNKD
    NCTC8325        MSDFNHTDHSTTNHSQTPRYRRPKFPWFKTVIVALIAGIIGALLVLGIGKVLNSTILNKD
    Newman          MSDFNHTDHSTTNHSQTPRYRRPKFPWFKTVIVALIAGIIGALLVLGIGKVLNSTILNKD
    USA300_FPR3757  MSDFNHTDHSTTNHSQTPRYRRPKFPWFKTVIVALIAGIIGALLVLGIGKVLNSTILNKD
                    ************************************************************

    COL             GSTVQTTNNKGGNQLDGQSKKFGTVHEMIKSVSPTIVGVINMQKASSVDDLLKGKSSKPS
    N315            GSTVQTTNNKGGNQLDGQSKKFGTVHEMIKSVSPTIVGVINMQKASSVDDLLKGKSSKPS
    NCTC8325        GSTVQTTNNKGGNQLDGQSKKFGTVHEMIKSVSPTIVGVINMQKASSVDDLLKGKSSKPS
    Newman          GSTVQTTNNKGGNQLDGQSKKFGTVHEMIKSVSPTIVGVINMQKASSVDDLLKGKSSKPS
    USA300_FPR3757  GSTVQTTNNKGGNQLDGQSKKFGTVHEMIKSVSPTIVGVINMQKASSVDDLLKGKSSKPS
                    ************************************************************

    COL             EAGVGSGVIYQINNNSAYIVTNNHVIDGANEIRVQLHNKKQVKAKLVGKDAVTDIAVLKI
    N315            EAGVGSGVIYQINNNSAYIVTNNHVIDGANEIRVQLHNKKQVKAKLVGKDAVTDIAVLKI
    NCTC8325        EAGVGSGVIYQINNNSAYIVTNNHVIDGANEIRVQLHNKKQVKAKLVGKDAVTDIAVLKI
    Newman          EAGVGSGVIYQINNNSAYIVTNNHVIDGANEIRVQLHNKKQVKAKLVGKDAVTDIAVLKI
    USA300_FPR3757  EAGVGSGVIYQINNNSAYIVTNNHVIDGANEIRVQLHNKKQVKAKLVGKDAVTDIAVLKI
                    ************************************************************

    COL             ENTKGIKAIQFANSSKVQTGDSVFAMGNPLGLQFANSVTSGIISASERTIDAETTGGNTK
    N315            ENTKGIKAIQFANSSKVQTGDSVFAMGNPLGLQFANSVTSGIISASERTIDAETTGGNTK
    NCTC8325        ENTKGIKAIQFANSSKVQTGDSVFAMGNPLGLQFANSVTSGIISASERTIDAETTGGNTK
    Newman          ENTKGIKAIQFANSSKVQTGDSVFAMGNPLGLQFANSVTSGIISASERTIDAETTGGNTK
    USA300_FPR3757  ENTKGIKAIQFANSSKVQTGDSVFAMGNPLGLQFANSVTSGIISASERTIDAETTGGNTK
                    ************************************************************

    COL             VSVLQTDAAINPGNSGGALVDINGNLVGINSMKIAATQVEGIGFAIPSNEVKVTIEQLVK
    N315            VSVLQTDAAINPGNSGGALVDINGNLVGINSMKIAATQVEGIGFAIPSNEVKVTIEQLVK
    NCTC8325        VSVLQTDAAINPGNSGGALVDINGNLVGINSMKIAATQVEGIGFAIPSNEVKVTIEQLVK
    Newman          VSVLQTDAAINPGNSGGALVDINGNLVGINSMKIAATQVEGIGFAIPSNEVKVTIEQLVK
    USA300_FPR3757  VSVLQTDAAINPGNSGGALVDINGNLVGINSMKIAATQVEGIGFAIPSNEVKVTIEQLVK
                    ************************************************************

    COL             HGKIDRPSIGIGLINLKDIPEEEREQLHTDREDGIYVAKADSDIDLKKGDIITEIDGKKI
    N315            HGKIDRPSIGIGLINLKDIPEEEREQLHTDREDGIYVAKADSDIDLKKGDIITEIDGKKI
    NCTC8325        HGKIDRPSIGIGLINLKDIPEEEREQLHTDREDGIYVAKADSDIDLKKGDIITEIDGKKI
    Newman          HGKIDRPSIGIGLINLKDIPEEEREQLHTDREDGIYVAKADSDIDLKKGDIITEIDGKKI
    USA300_FPR3757  HGKIDRPSIGIGLINLKDIPEEEREQLHTDREDGIYVAKADSDIDLKKGDIITEIDGKKI
                    ************************************************************

    COL             KDDVDLRSYLYENKKPGESVTVTVIRDGKTKEVKVKLKQQKEQPKRQSRSERQSPGQGDR
    N315            KDDVDLRSYLYENKKPGESVTVTVIRDGKTKEVKVKLKQQKEQPKRQSRSERQSPGQGDR
    NCTC8325        KDDVDLRSYLYENKKPGESVTVTVIRDGKTKEVKVKLKQQKEQPKRQSRSERQSPGQGDR
    Newman          KDDVDLRSYLYENKKPGESVTVTVIRDGKTKEVKVKLKQQKEQPKRQSRSERQSPGQGDR
    USA300_FPR3757  KDDVDLRSYLYENKKPGESVTVTVIRDGKTKEVKVKLKQQKEQPKRQSRSERQSPGQGDR
                    ************************************************************

    COL             DFFR
    N315            DFFR
    NCTC8325        DFFR
    Newman          DFFR
    USA300_FPR3757  DFFR
                    ****