From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004402000
  • symbol?: aroA2
  • description?: bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase

      descriptions from strain specific annotations:

    • bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase
    • protein aroA
    • 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase / chorismate mutase
    • chorismate mutase I
    • Chorismate mutase I / 2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I beta, AroH/AroA I beta
    • DAHP synthetase-chorismate mutase
    • phospho-2-dehydro-3-deoxyheptonate aldolase
  • strand?: -
  • coordinates?: 4642111..4643202
  • synteny block?: BlockID0034060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1695
    08BA02176:
    C248_1782
    11819-97:
    MS7_1743
    71193:
    ST398NM01_1790
    ECT-R 2:
    ECTR2_1577 (aroA)
    ED133:
    SAOV_1723 (aroA_1)
    ED98:
    SAAV_1747
    HO 5096 0412:
    SAEMRSA15_16450
    JH1:
    SaurJH1_1827
    JH9:
    SaurJH9_1792
    JKD6008:
    SAA6008_01707
    JKD6159:
    SAA6159_01660
    LGA251:
    SARLGA251_16270
    M013:
    M013TW_1751
    MRSA252:
    SAR1815
    MSHR1132:
    SAMSHR1132_15870
    MSSA476:
    SAS1663
    Mu3:
    SAHV_1723
    Mu50:
    SAV1737
    MW2:
    MW1680
    RF122:
    SAB1597c (aroA)
    ST398:
    SAPIG1790 (aroF)
    T0131:
    SAT0131_01844
    TCH60:
    HMPREF0772_11416 (aroF)
    TW20:
    SATW20_17270
    USA300_TCH1516:
    USA300HOU_1727
    VC40:
    SAVC_07895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNKLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQGTRIYDPQREKEMLNDLIDS
    N315            MSNKLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQGTRIYDPQREKEMLNDLIDS
    NCTC8325        MSNKLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQGTRIYDPQREKEMLNDLIDS
    Newman          MSNKLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQGTRIYDPQREKEMLNDLIDS
    USA300_FPR3757  MSNKLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQGTRIYDPQREKEMLNDLIDS
                    ************************************************************

    COL             NKGPFNDNTIKQLFKEIFKASTDLQKSENEKHLYVSRKLKPEDTIVTFDNGGIIGDGNKS
    N315            NKGPFNDNTIKQLFKEIFKASTDLQKSENEKHLYVSRKLKPEDTIVTFDNGGIIGDGNKS
    NCTC8325        NKGPFNDNTIKQLFKEIFKASTDLQKSENEKHLYVSRKLKPEDTIVTFDNGGIIGDGNKS
    Newman          NKGPFNDNTIKQLFKEIFKASTDLQKSENEKHLYVSRKLKPEDTIVTFDNGGIIGDGNKS
    USA300_FPR3757  NKGPFNDNTIKQLFKEIFKASTDLQKSENEKHLYVSRKLKPEDTIVTFDNGGIIGDGNKS
                    ************************************************************

    COL             FVFGPCSVESFEQVEAVAKNLHAKGEKFIRGGAFKPRTSPYDFQGLGVEGLKILKQIKDK
    N315            FVFGPCSVESFEQVEAVAKNLHAKGEKFIRGGAFKPRTSPYDFQGLGVEGLKILKQIKDK
    NCTC8325        FVFGPCSVESFEQVEAVAKNLHAKGEKFIRGGAFKPRTSPYDFQGLGVEGLKILKQIKDK
    Newman          FVFGPCSVESFEQVEAVAKNLHAKGEKFIRGGAFKPRTSPYDFQGLGVEGLKILKQIKDK
    USA300_FPR3757  FVFGPCSVESFEQVEAVAKNLHAKGEKFIRGGAFKPRTSPYDFQGLGVEGLKILKQIKDK
                    ************************************************************

    COL             YDLNVVSEIVNPNDFEVADEYLDVFQIGARNMQNFELLKEAGRTKKPILLKRGLSATIEE
    N315            YDLNVVSEIVNPNDFEVADEYLDVFQIGARNMQNFELLKEAGRTKKPILLKRGLSATIEE
    NCTC8325        YDLNVVSEIVNPNDFEVADEYLDVFQIGARNMQNFELLKEAGRTKKPILLKRGLSATIEE
    Newman          YDLNVVSEIVNPNDFEVADEYLDVFQIGARNMQNFELLKEAGRTKKPILLKRGLSATIEE
    USA300_FPR3757  YDLNVVSEIVNPNDFEVADEYLDVFQIGARNMQNFELLKEAGRTKKPILLKRGLSATIEE
                    ************************************************************

    COL             FVYAAEYIASQGNQNIILCERGIRTYEKATRNTLDISAVPILKQGTHLPVMVDVTHSTGR
    N315            FVYAAEYIASQGNQNIILCERGIRTYEKATRNTLDISAVPILKQGTHLPVMVDVTHSTGR
    NCTC8325        FVYAAEYIASQGNQNIILCERGIRTYEKATRNTLDISAVPILKQGTHLPVMVDVTHSTGR
    Newman          FVYAAEYIASQGNQNIILCERGIRTYEKATRNTLDISAVPILKQGTHLPVMVDVTHSTGR
    USA300_FPR3757  FVYAAEYIASQGNQNIILCERGIRTYEKATRNTLDISAVPILKQGTHLPVMVDVTHSTGR
                    ************************************************************

    COL             KDIMLPTAKAALAVGADGVMAEVHPDPSVALSDAGQQMDLDEFQAFYDELKPLADLYNAK
    N315            KDIMLPTAKAALAVGADGVMAEVHPDPSVALSDAGQQMDLDEFQAFYDELKPLADLYNAK
    NCTC8325        KDIMLPTAKAALAVGADGVMAEVHPDPSVALSDAGQQMDLDEFQAFYDELKPLADLYNAK
    Newman          KDIMLPTAKAALAVGADGVMAEVHPDPSVALSDAGQQMDLDEFQAFYDELKPLADLYNAK
    USA300_FPR3757  KDIMLPTAKAALAVGADGVMAEVHPDPSVALSDAGQQMDLDEFQAFYDELKPLADLYNAK
                    ************************************************************

    COL             KLK
    N315            KLK
    NCTC8325        KLK
    Newman          KLK
    USA300_FPR3757  KLK
                    ***