From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004408000
  • symbol?:
  • description?: DNA translocase FtsK

      descriptions from strain specific annotations:

    • DNA translocase FtsK
    • FtsK/SpoIIIE family protein
    • FtsK/SpoIIIE (DNA translocase stage III) family protein
    • Cell division protein FtsK
    • DNA translocase stage III sporulation prot-like protein
    • SpoIIIE family cell division protein
  • strand?: -
  • coordinates?: 4650349..4656553
  • synteny block?: BlockID0034120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1699 (ftsK)
    08BA02176:
    C248_1786
    11819-97:
    MS7_1747
    71193:
    ST398NM01_1794
    ECT-R 2:
    ECTR2_1581
    ED133:
    SAOV_1727
    ED98:
    SAAV_1751
    HO 5096 0412:
    SAEMRSA15_16490
    JH1:
    SaurJH1_1831
    JH9:
    SaurJH9_1796
    JKD6008:
    SAA6008_01712
    JKD6159:
    SAA6159_01664
    LGA251:
    SARLGA251_16310
    M013:
    M013TW_1755
    MRSA252:
    SAR1819
    MSHR1132:
    SAMSHR1132_15910
    MSSA476:
    SAS1667
    Mu3:
    SAHV_1727
    Mu50:
    SAV1741
    MW2:
    MW1684
    RF122:
    SAB1601c
    ST398:
    SAPIG1794
    T0131:
    SAT0131_01849
    TCH60:
    HMPREF0772_11412
    TW20:
    SATW20_17310
    USA300_TCH1516:
    USA300HOU_1731
    VC40:
    SAVC_07915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSWFDKLFGEDNDSNDDLIHRKKKRRQESQNIDNDHDSLLPQNNDIYSRPRGKFRFPMSV
    N315            MSWFDKLFGEDNDSNDDLIHRKKKRRQESQNIDNDHDSLLPQNNDIYSRPRGKFRFPMSV
    NCTC8325        MSWFDKLFGEDNDSNDDLIHRKKKRRQESQNIDNDHDSLLPQNNDIYSRPRGKFRFPMSV
    Newman          MSWFDKLFGEDNDSNDDLIHRKKKRRQESQNIDNDHDSLLPQNNDIYSRPRGKFRFPMSV
    USA300_FPR3757  MSWFDKLFGEDNDSNDDLIHRKKKRRQESQNIDNDHDSLLPQNNDIYSRPRGKFRFPMSV
                    ************************************************************

    COL             AYENENVEQSADTISDEKEQYHRDYRKQSHDSRSQKRHRRRRNQTTEEQNYSEQRGNSKI
    N315            AYENENVEQSADTISDEKEQYHRDYRKQSHDSRSQKRHRRRRNQTTEEQNYSEQRGNSKI
    NCTC8325        AYENENVEQSADTISDEKEQYHRDYRKQSHDSRSQKRHRRRRNQTTEEQNYSEQRGNSKI
    Newman          AYENENVEQSADTISDEKEQYHRDYRKQSHDSRSQKRHRRRRNQTTEEQNYSEQRGNSKI
    USA300_FPR3757  AYENENVEQSADTISDEKEQYHRDYRKQSHDSRSQKRHRRRRNQTTEEQNYSEKRGNSKI
                    *****************************************************:******

    COL             SQQSIKYKDHSHYHTNKPGTYVSAINGIEKETHKPKTHNMYSNNTNHRAKDSTPDYHKES
    N315            SQQSIKYKDHSHYHTNKPGTYVSAINGIEKETHKSKTHNMYSNNTNHRAKDSTPDYHKES
    NCTC8325        SQQSIKYKDHSHYHTNKPGTYVSAINGIEKETHKPKTHNMYSNNTNHRAKDSTPDYHKES
    Newman          SQQSIKYKDHSHYHTNKPGTYVSAINGIEKETHKPKTHNMYSNNTNHRAKDSTPDYHKES
    USA300_FPR3757  SQQSIKYKDHSHYHTNKPGTYVSAINGIEKETHKPKTHNMYSNNTNHRAKDSTPDYHKES
                    **********************************.*************************

    COL             FKTSEVPSAIFGTMKPKKLENGRIPVSKPSEKVESDKQKYDKYVAKTQTSQNKQLEQEKQ
    N315            FKTSEVPSAIFGTMKPKKLENGRIPVSKPSEKVESDKQKYDKYVAKTQTSQNKQLEQEKQ
    NCTC8325        FKTSEVPSAIFGTMKPKKLENGRIPVSKPSEKVESDKQKYDKYVAKTQTSQNKQLEQEKQ
    Newman          FKTSEVPSAIFGTMKPKKLENGRIPVSKPSEKVESDKQKYDKYVAKTQTSQNKQLEQEKQ
    USA300_FPR3757  FKTSEVPSAIFGTMKPKKLENGRIPVSKPSEKVESDKQKYDKYVAKTQTSQNKQLEQEKQ
                    ************************************************************

    COL             NDSVVKQGTASKSSDENVSSTTKSMPNYSKVDNTIKIENIYASQIVEEIRRERERKVLQK
    N315            NDSVVKQGTASKSSDENVSSTTKSMPNYSKVDNTIKIENIYASQIVEEIRRERERKVLQK
    NCTC8325        NDSVVKQGTASKSSDENVSSTTKSMPNYSKVDNTIKIENIYASQIVEEIRRERERKVLQK
    Newman          NDSVVKQGTASKSSDENVSSTTKSMPNYSKVDNTIKIENIYASQIVEEIRRERERKVLQK
    USA300_FPR3757  NDSVVKQGTASKSSDENVSSTTKSMPNYSKVDNTIKIENIYASQIVEEIRRERERKVLQK
                    ************************************************************

    COL             RRFKKALQQKREEHKNEEQDAIQRAIDEMYAKQAERYVGDSSLNDDSDLTDNSTDASQLH
    N315            RRFKKALQQKREEHKNEEQDAIQRAIDEMYAKQAERYVGDSSLNDDSDLTDNSTDASQLH
    NCTC8325        RRFKKALQQKREEHKNEEQDAIQRAIDEMYAKQAERYVGDSSLNDDSDLTDNSTDASQLH
    Newman          RRFKKALQQKREEHKNEEQDAIQRAIDEMYAKQAERYVGDSSLNDDSDLTDNSTDASQLH
    USA300_FPR3757  RRFKKALQQKREEHKNEEQDAIQRAIDEMYAKQAERYVGDSSLNDDSDLTDNSTDASQLH
                    ************************************************************

    COL             TNGIENETVSNDENKQASIQNEDTNDTHVDESPYNYEEVSLNQVSTTKQLSDDEVTVSNV
    N315            TNGIENETVSNDENKQASIQNEDTNDTHVDESPYNYEEVSLNQVSTTKQLSDDEVTVSNV
    NCTC8325        TNGIENETVSNDENKQASIQNEDTNDTHVDESPYNYEEVSLNQVSTTKQLSDDEVTVSNV
    Newman          TNGIENETVSNDENKQASIQNEDTNDTHVDESPYNYEEVSLNQVSTTKQLSDDEVTVSNV
    USA300_FPR3757  TNGIENETVSNDENKQASIQNEDTNDTHVDESPYNYEEVSLNQVSTTKQLSDDEVTVSNV
                    ************************************************************

    COL             TSQHQSALQHNVEVNDKDELKNQSRLIADSEEDGATNKEEYSGSQIDDAEFYELNDTEVD
    N315            TSQHQSALQHNVEVNDKDELKNQSRLIADSEEDGATNKEEYSGSQIDDAEFYELNDTEVD
    NCTC8325        TSQHQSALQHNVEVNDKDELKNQSRLIADSEEDGATNKEEYSGSQIDDAEFYELNDTEVD
    Newman          TSQHQSALQHNVEVNDKDELKNQSRLIADSEEDGATNKEEYSGSQIDDAEFYELNDTEVD
    USA300_FPR3757  TSQHQSALQHNVEVNDKDELKNQSRLIADSEEDGATNKEEYSGSQIDDAEFYELNDTEVD
                    ************************************************************

    COL             EDTTSNIEDNTNRNASEMHVDAPKTQEYAVTESQVNNIDKTVDNEIELAPRHKKDDQTNL
    N315            EDTTSNIEDNTNRNASEMHVDAPKTQEHAVTESQVNNIDKTVDNEIELAPRHKKDDQTNL
    NCTC8325        EDTTSNIEDNTNRNASEMHVDAPKTQEYAVTESQVNNIDKTVDNEIELAPRHKKDDQTNL
    Newman          EDTTSNIEDNTNRNASEMHVDAPKTQEYAVTESQVNNIDKTVDNEIELAPRHKKDDQTNL
    USA300_FPR3757  EDTTSNIEDNTNRNASEMHVDAPKTQEYAVTESQVNNIDKTVDNEIELAPRHKKDDQTNL
                    ***************************:********************************

    COL             SVNSLKTNDVNDNHVVEDSSMNEIEKNNAEITENVQNEAAESEQNVEEKTIENVNPKKQT
    N315            NVNSLKTNDVNDGHVVEDSSMNEIEKHNAEITENVQNEAAESEQNVEEKTIENVNPKKQT
    NCTC8325        SVNSLKTNDVNDNHVVEDSSMNEIEKNNAEITENVQNEAAESEQNVEEKTIENVNPKKQT
    Newman          SVNSLKTNDVNDNHVVEDSSMNEIEKNNAEITENVQNEAAESEQNVEEKTIENVNPKKQT
    USA300_FPR3757  SVNSLKTNDVNDNHVVEDSSMNEIEKNNAEITENVQNEAAESEQNVEEKTIENVNPKKQT
                    .***********.*************:*********************************

    COL             EKVSTLSKRPFNVVMTPSDKKRMMDRKKHSKVNVPELKPVQSKQAVSERMPASQATPSSR
    N315            EKVSTLSKRPFNVVMTPSDKKRMMDRKKHSKVNVPELKPVQSKQAVSESKPASQAAPSSR
    NCTC8325        EKVSTLSKRPFNVVMTPSDKKRMMDRKKHSKVNVPELKPVQSKQAVSERMPASQATPSSR
    Newman          EKVSTLSKRPFNVVMTPSDKKRMMDRKKHSKVNVPELKPVQSKQAVSERMPASQATPSSR
    USA300_FPR3757  EKVSTLSKRPFNVVMTPSDKKRMMDRKKHSKVNVPELKPVQSKQAVSERMPASQATPSSR
                    ************************************************  *****:****

    COL             SDSQESNTNAYKTNNMTSNNVENNQLIGHAETENDYQNAQQYSEQKPSVDSTQTEIFEES
    N315            SDSQESNTNAYKTNNMTSNNVENNQLIGHAETENDYQNAQQYSEQKPSADSTQTEIFEES
    NCTC8325        SDSQESNTNAYKTNNMTSNNVENNQLIGHAETENDYQNAQQYSEQKPSVDSTQTEIFEES
    Newman          SDSQESNTNAYKTNNMTSNNVENNQLIGHAETENDYQNAQQYSEQKPSVDSTQTEIFEES
    USA300_FPR3757  SDSQESNTNAYKTNNMTSNNVENNQLIGHAETENDYQNAQQYSEQKPSVDSTQTEIFEES
                    ************************************************.***********

    COL             QDDNQLENEQVDQSTSSSVSEVSDITEESEETTHPNNTSGQQDNDDQQKDLQSSFSNKNE
    N315            QDDNQLENEQVDQSTSSSVSEVSDITEESEETTHPNNTSGQQDNDDQQKDLQPSFSNQNE
    NCTC8325        QDDNQLENEQVDQSTSSSVSEVSDITEESEETTHPNNTSGQQDNDDQQKDLQSSFSNKNE
    Newman          QDDNQLENEQVDQSTSSSVSEVSDITEESEETTHPNNTSGQQDNDDQQKDLQSSFSNKNE
    USA300_FPR3757  QDDNQLENEQVDQSTSSSVSEVSDITEESEETTHPNNTSGQQDNDDQQKDLQSSFSNKNE
                    ****************************************************.****:**

    COL             DTANENRPRTNQQDVATNQAVQTSKPMIRKGPNIKLPSVSLLEEPQVIESDEDWITDKKK
    N315            DTANENRPRTNQQDVATNQAVQTSKPMIRKGPNIKLPSVSLLEEPQVIESDEDWITDKKK
    NCTC8325        DTANENRPRTNQQDVATNQAVQTSKPMIRKGPNIKLPSVSLLEEPQVIESDEDWITDKKK
    Newman          DTANENRPRTNQQDVATNQAVQTSKPMIRKGPNIKLPSVSLLEEPQVIESDEDWITDKKK
    USA300_FPR3757  DTANENRPRTNQQDVATNQAVQTSKPMIRKGPNIKLPSVSLLEEPQVIESDEDWITDKKK
                    ************************************************************

    COL             ELNDALFYFNVPAEVQDVTEGPSVTRFELSVEKGVKVSRITALQDDIKMALAAKDIRIEA
    N315            ELNDALFYFNVPAEVQDVTEGPSVTRFELSVEKGVKVSRITALQDDIKMALAAKDIRIEA
    NCTC8325        ELNDALFYFNVPAEVQDVTEGPSVTRFELSVEKGVKVSRITALQDDIKMALAAKDIRIEA
    Newman          ELNDALFYFNVPAEVQDVTEGPSVTRFELSVEKGVKVSRITALQDDIKMALAAKDIRIEA
    USA300_FPR3757  ELNDALFYFNVPAEVQDVTEGPSVTRFELSVEKGVKVSRITALQDDIKMALAAKDIRIEA
                    ************************************************************

    COL             PIPGTSRVGIEVPNQNPTTVNLRSIIESPSFKNAESKLTVAMGYRINNEPLLMDIAKTPH
    N315            PIPGTSRVGIEVPNQNPTTVNLRSIIESPSFKNAESKLTVAMGYRINNEPLLMDIAKTPH
    NCTC8325        PIPGTSRVGIEVPNQNPTTVNLRSIIESPSFKNAESKLTVAMGYRINNEPLLMDIAKTPH
    Newman          PIPGTSRVGIEVPNQNPTTVNLRSIIESPSFKNAESKLTVAMGYRINNEPLLMDIAKTPH
    USA300_FPR3757  PIPGTSRVGIEVPNQNPTTVNLRSIIESPSFKNAESKLTVAMGYRINNEPLLMDIAKTPH
                    ************************************************************

    COL             ALIAGATGSGKSVCINSILMSLLYKNHPEELRLLLIDPKMVELAPYNGLPHLVAPVITDV
    N315            ALIAGATGSGKSVCINSILMSLLYKNHPEELRLLLIDPKMVELAPYNGLPHLVAPVITDV
    NCTC8325        ALIAGATGSGKSVCINSILMSLLYKNHPEELRLLLIDPKMVELAPYNGLPHLVAPVITDV
    Newman          ALIAGATGSGKSVCINSILMSLLYKNHPEELRLLLIDPKMVELAPYNGLPHLVAPVITDV
    USA300_FPR3757  ALIAGATGSGKSVCINSILMSLLYKNHPEELRLLLIDPKMVELAPYNGLPHLVAPVITDV
                    ************************************************************

    COL             KAATQSLKWAVEEMERRYKLFAHYHVRNITAFNKKAPYDERMPKIVIVIDELADLMMMAP
    N315            KAATQSLKWAVEEMERRYKLFAHYHVRNITAFNKKAPYDERMPKIVIVIDELADLMMMAP
    NCTC8325        KAATQSLKWAVEEMERRYKLFAHYHVRNITAFNKKAPYDERMPKIVIVIDELADLMMMAP
    Newman          KAATQSLKWAVEEMERRYKLFAHYHVRNITAFNKKAPYDERMPKIVIVIDELADLMMMAP
    USA300_FPR3757  KAATQSLKWAVEEMERRYKLFAHYHVRNITAFNKKAPYDERMPKIVIVIDELADLMMMAP
                    ************************************************************

    COL             QEVEQSIARIAQKARACGIHMLVATQRPSVNVITGLIKANIPTRIAFMVSSSVDSRTILD
    N315            QEVEQSIARIAQKARACGIHMLVATQRPSVNVITGLIKANIPTRIAFMVSSSVDSRTILD
    NCTC8325        QEVEQSIARIAQKARACGIHMLVATQRPSVNVITGLIKANIPTRIAFMVSSSVDSRTILD
    Newman          QEVEQSIARIAQKARACGIHMLVATQRPSVNVITGLIKANIPTRIAFMVSSSVDSRTILD
    USA300_FPR3757  QEVEQSIARIAQKARACGIHMLVATQRPSVNVITGLIKANIPTRIAFMVSSSVDSRTILD
                    ************************************************************

    COL             SGGAERLLGYGDMLYLGSGMNKPIRVQGTFVSDDEIDDVVDFIKQQREPDYLFEEKELLK
    N315            SGGAERLLGYGDMLYLGSGMNKPIRVQGTFVSDDEIDDVVDFIKQQREPDYLFEEKELLK
    NCTC8325        SGGAERLLGYGDMLYLGSGMNKPIRVQGTFVSDDEIDDVVDFIKQQREPDYLFEEKELLK
    Newman          SGGAERLLGYGDMLYLGSGMNKPIRVQGTFVSDDEIDDVVDFIKQQREPDYLFEEKELLK
    USA300_FPR3757  SGGAERLLGYGDMLYLGSGMNKPIRVQGTFVSDDEIDDVVDFIKQQREPDYLFEEKELLK
                    ************************************************************

    COL             KTQTQSQDELFDDVCAFMVNEGHISTSLIQRHFQIGYNRAARIIDQLEQLGYVSSANGSK
    N315            KTQTQSQDELFDDVCAFMVNEGHISTSLIQRHFQIGYNRAARIIDQLEQLGYVSSANGSK
    NCTC8325        KTQTQSQDELFDDVCAFMVNEGHISTSLIQRHFQIGYNRAARIIDQLEQLGYVSSANGSK
    Newman          KTQTQSQDELFDDVCAFMVNEGHISTSLIQRHFQIGYNRAARIIDQLEQLGYVSSANGSK
    USA300_FPR3757  KTQTQSQDELFDDVCAFMVNEGHISTSLIQRHFQIGYNRAARIIDQLEQLGYVSSANGSK
                    ************************************************************

    COL             PRDVYVTEADLNKE
    N315            PRDVYVTEADLNKE
    NCTC8325        PRDVYVTEADLNKE
    Newman          PRDVYVTEADLNKE
    USA300_FPR3757  PRDVYVTEADLNKE
                    **************