From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004429000
  • symbol?:
  • description?: dipeptidase PepV

      descriptions from strain specific annotations:

    • dipeptidase PepV
    • putative peptidase
    • Xaa-His dipeptidase
    • Peptidase family M20/M25/M40
    • dipeptidase, family protein
    • Putative dipeptidase
    • dipeptidase family protein
    • Xaa-His dipeptidase -like protein
    • peptidase protein
  • strand?: -
  • coordinates?: 4675363..4676772
  • synteny block?: BlockID0034270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1709
    08BA02176:
    C248_1798
    11819-97:
    MS7_1757
    71193:
    ST398NM01_1804
    ECT-R 2:
    ECTR2_1591
    ED133:
    SAOV_1737
    ED98:
    SAAV_1761
    HO 5096 0412:
    SAEMRSA15_16590
    JH1:
    SaurJH1_1841
    JH9:
    SaurJH9_1806
    JKD6008:
    SAA6008_01723
    JKD6159:
    SAA6159_01674
    LGA251:
    SARLGA251_16410
    M013:
    M013TW_1766
    MRSA252:
    SAR1836
    MSHR1132:
    SAMSHR1132_16010
    MSSA476:
    SAS1677
    Mu3:
    SAHV_1737
    Mu50:
    SAV1751
    MW2:
    MW1694
    RF122:
    SAB1611c
    ST398:
    SAPIG1804
    T0131:
    SAT0131_01860
    TCH60:
    HMPREF0772_11401 (pepV)
    TW20:
    SATW20_17410
    USA300_TCH1516:
    USA300HOU_1742
    VC40:
    SAVC_07965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
    N315            MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
    NCTC8325        MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
    Newman          MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
    USA300_FPR3757  MWKEKVQQYEDQIINDLKGLLAIESVRDDAKASEDAPVGPGPRKALDYMYEIAHRDGFTT
                    ************************************************************

    COL             HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
    N315            HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
    NCTC8325        HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
    Newman          HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
    USA300_FPR3757  HDVDHIAGRIEAGKGNDVLGILCHVDVVPAGDGWDSNPFEPVVTEDAIIARGTLDDKGPT
                    ************************************************************

    COL             IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
    N315            IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
    NCTC8325        IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
    Newman          IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
    USA300_FPR3757  IAAYYAIKILEDMNVDWKKRIHMIIGTDEESDWKCTDRYFKTEEMPTLGFAPDAEFPCIH
                    ************************************************************

    COL             GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
    N315            GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
    NCTC8325        GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
    Newman          GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
    USA300_FPR3757  GEKGITTFDLVQNKLTEDQDEPDYELITFKSGERYNMVPDHAEARVLVKENMTDVIQDFE
                    ************************************************************

    COL             YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
    N315            YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
    NCTC8325        YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
    Newman          YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
    USA300_FPR3757  YFLEQNHLQGDSTVDSGILVLTVEGKAVHGMDPSIGVNAGLYLLKFLASLNLDNNAQAFV
                    ************************************************************

    COL             AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
    N315            AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
    NCTC8325        AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
    Newman          AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
    USA300_FPR3757  AFSNRYLFNSDFGEKMGMKFHTDVMGDVTTNIGVITYDNENAGLFGINLRYPEGFEFEKA
                    ************************************************************

    COL             MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
    N315            MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
    NCTC8325        MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
    Newman          MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
    USA300_FPR3757  MDRFANEIQQYGFEVKLGKVQPPHYVDKNDPFVQKLVTAYRNQTNDMTEPYTIGGGTYAR
                    ************************************************************

    COL             NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
    N315            NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
    NCTC8325        NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
    Newman          NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
    USA300_FPR3757  NLDKGVAFGAMFSDSEDLMHQKNEYITKKQLFNATSIYLEAIYSLCVEE
                    *************************************************