From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004440000
  • symbol?:
  • description?: rhodanese domain-containing protein

      descriptions from strain specific annotations:

    • rhodanese domain-containing protein
    • rhodanese-like domain-containing protein
    • Rhodanese-like domain protein
    • sulfurtransferase
    • rhodanese domain sulfurtransferase
    • molybdopterin biosynthesis protein MoeB
    • conserved protein YtwF
    • Rhodanese-related sulfurtransferase
  • strand?: -
  • coordinates?: 4689612..4689923
  • synteny block?: BlockID0034380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1715
    08BA02176:
    C248_1804
    11819-97:
    MS7_1763
    71193:
    ST398NM01_1810
    ECT-R 2:
    ECTR2_1597
    ED133:
    SAOV_1743
    ED98:
    SAAV_1767
    HO 5096 0412:
    SAEMRSA15_16650
    JH1:
    SaurJH1_1847
    JH9:
    SaurJH9_1812
    JKD6008:
    SAA6008_01729
    JKD6159:
    SAA6159_01680
    LGA251:
    SARLGA251_16470
    M013:
    M013TW_1773
    MRSA252:
    SAR1842
    MSHR1132:
    SAMSHR1132_16070
    MSSA476:
    SAS1683
    Mu3:
    SAHV_1745
    Mu50:
    SAV1759
    MW2:
    MW1700
    RF122:
    SAB1617c
    ST398:
    SAPIG1810
    T0131:
    SAT0131_01866
    TCH60:
    HMPREF0772_11394
    TW20:
    SATW20_17470
    USA300_TCH1516:
    USA300HOU_1748
    VC40:
    SAVC_07995

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYY
    N315            MKSITTDELKNKLFESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYY
    NCTC8325        MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYY
    Newman          MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYY
    USA300_FPR3757  MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYY
                    *************:**********************************************

    COL             IVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
    N315            IVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
    NCTC8325        IVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
    Newman          IVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
    USA300_FPR3757  IVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
                    *******************************************