From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004444000
  • symbol?:
  • description?: multidrug resistance protein

      descriptions from strain specific annotations:

    • multidrug resistance protein
    • major facilitator transporter
    • major facilitator superfamily protein
    • drug transporter, putative
    • putative drug transporter
    • multidrug resistance transporter protein B
    • MFS family major facilitator transporter
    • multidrug resistance protein B
  • strand?: -
  • coordinates?: 4692657..4693800
  • synteny block?: BlockID0034420
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1717
    08BA02176:
    C248_1806
    11819-97:
    MS7_1765
    71193:
    ST398NM01_1812
    ECT-R 2:
    ECTR2_1599
    ED133:
    SAOV_1745
    ED98:
    SAAV_1770
    HO 5096 0412:
    SAEMRSA15_16670
    JH1:
    SaurJH1_1849
    JH9:
    SaurJH9_1814
    JKD6008:
    SAA6008_01731
    JKD6159:
    SAA6159_01682
    LGA251:
    SARLGA251_16490
    M013:
    M013TW_1775
    MRSA252:
    SAR1844
    MSHR1132:
    SAMSHR1132_16090
    MSSA476:
    SAS1685
    Mu3:
    SAHV_1747
    Mu50:
    SAV1761
    MW2:
    MW1702
    RF122:
    SAB1619c
    ST398:
    SAPIG1812
    T0131:
    TCH60:
    HMPREF0772_11392
    TW20:
    SATW20_17490
    USA300_TCH1516:
    USA300HOU_1750
    VC40:
    SAVC_08005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIPKSVWWLVIGMALNITGSSFLWPLNTIYMKQELGKSLTVAGLVLMINSFGMVIGNLL
    N315            MNIPKSVWWLVIGMALNITGSSFLWPLNTIYMKQELGKSLTVAGLVLMINSFGMVIGNLL
    NCTC8325        MNIPKSVWWLVIGMALNITGSSFLWPLNTIYMKQELGKSLTVAGLVLMINSFGMVIGNLL
    Newman          MNIPKSVWWLVIGMALNITGSSFLWPLNTIYMKQELGKSLTVAGLVLMINSFGMVIGNLL
    USA300_FPR3757  MNIPKSVWWLVIGMALNITGSSFLWPLNTIYMKQELGKSLTVAGLVLMINSFGMVIGNLL
                    ************************************************************

    COL             GGSLFDKLGGYKTILIGTFTCLCSTTLLNFFHGWPWYAVWLVMLGFGGGMIIPAIYAMAG
    N315            GGSLFDKLGGYKTILIGTFTCLCSTTLLNFFHGWPWYAVWLVMLGFGGGMIIPAIYAMAG
    NCTC8325        GGSLFDKLGGYKTILIGTFTCLCSTTLLNFFHGWPWYAVWLVMLGFGGGMIIPAIYAMAG
    Newman          GGSLFDKLGGYKTILIGTFTCLCSTTLLNFFHGWPWYAVWLVMLGFGGGMIIPAIYAMAG
    USA300_FPR3757  GGSLFDKLGGYKTILIGTFTCLCSTTLLNFFHGWPWYAVWLVMLGFGGGMIIPAIYAMAG
                    ************************************************************

    COL             AVWPNGGRQTFNAIYLAQNIGVAVGAAMGGFVAEFSFNYIFLANLIMYVVFALVAVTQFN
    N315            AVWPNGGRQTFNAIYLAQNIGVAVGAAMGGFVAEFSFNYIFLANLIMYVVFALVAVTQFN
    NCTC8325        AVWPNGGRQTFNAIYLAQNIGVAVGAAMGGFVAEFSFNYIFLANLIMYVVFALVAVTQFN
    Newman          AVWPNGGRQTFNAIYLAQNIGVAVGAAMGGFVAEFSFNYIFLANLIMYVVFALVAVTQFN
    USA300_FPR3757  AVWPNGGRQTFNAIYLAQNIGVAVGAAMGGFVAEFSFNYIFLANLIMYVVFALVAVTQFN
                    ************************************************************

    COL             IEINAKVKYPTHLDITGKKNKARFISLVLICAMFAICWVAYIQWESTIASFTQSINISMA
    N315            IEINAKVKYPTHLDITGKKNKARFISLVLICAMFAICWVAYIQWESTIASFTQSINISMA
    NCTC8325        IEINAKVKYPTHLDITGKKNKARFISLVLICAMFAICWVAYIQWESTIASFTQSINISMA
    Newman          IEINAKVKYPTHLDITGKKNKARFISLVLICAMFAICWVAYIQWESTIASFTQSINISMA
    USA300_FPR3757  IEINAKVKYPTHLDITGKKNKARFISLVLICAMFAICWVAYIQWESTIASFTQSINISMA
                    ************************************************************

    COL             QYSVLWTINGIMILVAQPLIKPILYLLKGNLKKQMFVGIIIFMLSFFVTSFAENFTIFVV
    N315            QYSVLWTINGIMILVAQPLIKPVLYLLKGNLKKQMFVGIIIFMLSFFVTSFAENFTIFVV
    NCTC8325        QYSVLWTINGIMILVAQPLIKPILYLLKGNLKKQMFVGIIIFMLSFFVTSFAENFTIFVV
    Newman          QYSVLWTINGIMILVAQPLIKPILYLLKGNLKKQMFVGIIIFMLSFFVTSFAENFTIFVV
    USA300_FPR3757  QYSVLWTINGIMILVAQPLIKPILYLLKGNLKKQMFVGIIIFMLSFFVTSFAENFTIFVV
                    **********************:*************************************

    COL             GMIILTFGEMFVWPAVPTIANQLAPDGKQGQYQGFVNSAATVGKAFGPFLGGVLVDAFNM
    N315            GMIILTFGEMFVWPAVPTIANQLAPDGKQGQYQGFVNSAATVGKAFGPFLGGVLVDAFNM
    NCTC8325        GMIILTFGEMFVWPAVPTIANQLAPDGKQGQYQGFVNSAATVGKAFGPFLGGVLVDAFNM
    Newman          GMIILTFGEMFVWPAVPTIANQLAPDGKQGQYQGFVNSAATVGKAFGPFLGGVLVDAFNM
    USA300_FPR3757  GMIILTFGEMFVWPAVPTIANQLAPDGKQGQYQGFVNSAATVGKAFGPFLGGVLVDAFNM
                    ************************************************************

    COL             RMMFIGMMLLLVFALILLMVFKENNTQPKKIDA
    N315            RMMFIGMMLLLVFALILLMVFKENNTQPKKIDA
    NCTC8325        RMMFIGMMLLLVFALILLMVFKENNTQPKKIDA
    Newman          RMMFIGMMLLLVFALILLMVFKENNTQPKKIDA
    USA300_FPR3757  RMMFIGMMLLLVFALILLMVFKENNTQPKKIDA
                    *********************************