From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004456000
  • symbol?: ribA
  • description?: riboflavin biosynthesis protein

      descriptions from strain specific annotations:

    • riboflavin biosynthesis protein
    • 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II
    • riboflavin biosynthesis protein ribBA
    • bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II
    • riboflavin biosynthesis protein ribAB
  • strand?: -
  • coordinates?: 4703229..4704410
  • synteny block?: BlockID0034530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1818 (ribBA)
    N315:
    SA1587 (ribA)
    NCTC8325:
    Newman:
    NWMN_1660 (ribA)
    USA300_FPR3757:
    SAUSA300_1713 (ribBA)
    04-02981:
    SA2981_1724 (ribA)
    08BA02176:
    C248_1814 (ribA)
    11819-97:
    MS7_1772 (ribA)
    71193:
    ST398NM01_1820
    ECT-R 2:
    ECTR2_1606 (ribB)
    ED133:
    SAOV_1752 (ribA)
    ED98:
    SAAV_1778 (ribBA)
    HO 5096 0412:
    SAEMRSA15_16750 (ribA)
    JH1:
    SaurJH1_1856
    JH9:
    SaurJH9_1821
    JKD6008:
    SAA6008_01741 (ribA)
    JKD6159:
    SAA6159_01689 (ribA)
    LGA251:
    SARLGA251_16560 (ribA)
    M013:
    M013TW_1782
    MRSA252:
    SAR1851 (ribA)
    MSHR1132:
    SAMSHR1132_16160
    MSSA476:
    SAS1692
    Mu3:
    SAHV_1754 (ribA)
    Mu50:
    SAV1769 (ribA)
    MW2:
    MW1709 (ribA)
    RF122:
    SAB1626c (ribA)
    ST398:
    SAPIG1820
    T0131:
    SAT0131_01883
    TCH60:
    HMPREF0772_11385 (ribBA)
    TW20:
    SATW20_17590 (ribA)
    USA300_TCH1516:
    USA300HOU_1758 (ribA)
    VC40:
    SAVC_08050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQFDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPV
    N315            MQFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPV
    NCTC8325        MQFDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPV
    Newman          MQFDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPV
    USA300_FPR3757  MQFDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPV
                    *****************.******************************************

    COL             SKDIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDF
    N315            SKDIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDF
    NCTC8325        SKDIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDF
    Newman          SKDIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDF
    USA300_FPR3757  SKDIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDF
                    ************************************************************

    COL             NRPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKF
    N315            NRPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNF
    NCTC8325        NRPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKF
    Newman          NRPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKF
    USA300_FPR3757  NRPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKF
                    **********************************************************:*

    COL             KEKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKG
    N315            KEKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKG
    NCTC8325        KEKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKG
    Newman          KEKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKG
    USA300_FPR3757  KEKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKG
                    ************************************************************

    COL             AIRQHENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLNK
    N315            AIRQHENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLNK
    NCTC8325        AIRQHENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLNK
    Newman          AIRQHENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLNK
    USA300_FPR3757  AIRQHENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLNK
                    ************************************************************

    COL             LRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQY
    N315            LRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQY
    NCTC8325        LRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQY
    Newman          LRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQY
    USA300_FPR3757  LRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQY
                    ************************************************************

    COL             GIDIAERIEVIVPETVHNHDYMETKKIKMGHLI
    N315            GIDIAERIEVIVPETVHNHDYMVTKKIKMGHLI
    NCTC8325        GIDIAERIEVIVPETVHNHDYMETKKIKMGHLI
    Newman          GIDIAERIEVIVPETVHNHDYMETKKIKMGHLI
    USA300_FPR3757  GIDIAERIEVIVPETVHNHDYMETKKIKMGHLI
                    ********************** **********