From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004457000
  • symbol?: ribB
  • description?: riboflavin synthase subunit alpha

      descriptions from strain specific annotations:

    • riboflavin synthase subunit alpha
    • Riboflavin synthase alpha chain
    • riboflavin synthase, alpha subunit
  • strand?: -
  • coordinates?: 4704421..4705053
  • synteny block?: BlockID0034540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1819 (ribE)
    N315:
    SA1588 (ribB)
    NCTC8325:
    Newman:
    NWMN_1661 (ribB)
    USA300_FPR3757:
    04-02981:
    SA2981_1725 (ribB)
    08BA02176:
    C248_1815 (ribE)
    11819-97:
    MS7_1773 (ribE)
    71193:
    ST398NM01_1821
    ECT-R 2:
    ECTR2_1607 (ribE)
    ED133:
    SAOV_1753 (ribE)
    ED98:
    SAAV_1779 (ribE)
    HO 5096 0412:
    SAEMRSA15_16760 (ribE)
    JH1:
    SaurJH1_1857
    JH9:
    SaurJH9_1822
    JKD6008:
    SAA6008_01742 (ribB)
    JKD6159:
    SAA6159_01690 (ribB)
    LGA251:
    SARLGA251_16570 (ribE)
    M013:
    M013TW_1783
    MRSA252:
    SAR1852 (ribE)
    MSHR1132:
    SAMSHR1132_16170
    MSSA476:
    SAS1693
    Mu3:
    SAHV_1755 (ribB)
    Mu50:
    SAV1770 (ribB)
    MW2:
    MW1710 (ribB)
    RF122:
    SAB1627c (ribE)
    ST398:
    SAPIG1821 (ribE)
    T0131:
    SAT0131_01884
    TCH60:
    HMPREF0772_11384 (ribE)
    TW20:
    SATW20_17600 (ribE)
    USA300_TCH1516:
    USA300HOU_1759 (ribB)
    VC40:
    SAVC_08055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFTGIVEEIGVVKSVQIRQSVRTIEIEAHKITADMHIGDSISVNGACLTVIDFNQTSFTV
    N315            MFTGIVEEIGVVKSVQIRQSVRTIEIEAHKITADMHIGDSISVNGACLTVIDFDQTSFTV
    NCTC8325        MFTGIVEEIGVVKSVQIRQSVRTIEIEAHKITADMHIGDSISVNGACLTVIDFNQTSFTV
    Newman          MFTGIVEEIGVVKSVQIRQSVRTIEIEAHKITADMHIGDSISVNGACLTVIDFNQTSFTV
    USA300_FPR3757  MFTGIVEEIGVVKSVQIRQSVRTIEIEAHKITADMHIGDSISVNGACLTVIDFNQTSFTV
                    *****************************************************:******

    COL             QVIKGTENKTYLADVKRQSEVNLERAMSGNGRFGGHFVLGHVDELGTVSKINETANAKII
    N315            QVIKSTENKTYLADVKRQSEVNLERAMSGNGRFGGHFVLGHVDELGTVSKINETANAKII
    NCTC8325        QVIKGTENKTYLADVKRQSEVNLERAMSGNGRFGGHFVLGHVDELGTVSKINETANAKII
    Newman          QVIKGTENKTYLADVKRQSEVNLERAMSGNGRFGGHFVLGHVDELGTVSKINETANAKII
    USA300_FPR3757  QVIKGTENKTYLADVKRQSEVNLERAMSGNGRFGGHFVLGHVDELGTVSKINETANAKII
                    ****.*******************************************************

    COL             TIQCSQHINNQLVKQGSITVDGVSLTVFDKHDNSFDIHLIPETRRSTILSSKKLGDKVHL
    N315            TIQCSQHINNQLVKQGSITVDGVSLTVFDKHDNSFDIHLIPETRRSTILSSKKLGDKVHL
    NCTC8325        TIQCSQHINNQLVKQGSITVDGVSLTVFDKHDNSFDIHLIPETRRSTILSSKKLGDKVHL
    Newman          TIQCSQHINNQLVKQGSITVDGVSLTVFDKHDNSFDIHLIPETRRSTILSSKKLGDKVHL
    USA300_FPR3757  TIQCSQHINNQLVKQGSITVDGVSLTVFDKHDNSFDIHLIPETRRSTILSSKKLGDKVHL
                    ************************************************************

    COL             ETDVLFKYVENILNKDKDQLSVDKLRAFGF
    N315            ETDVLFKYVENILNKDKDQLSVDKLRAFGF
    NCTC8325        ETDVLFKYVENILNKDKDQLSVDKLRAFGF
    Newman          ETDVLFKYVENILNKDKDQLSVDKLRAFGF
    USA300_FPR3757  ETDVLFKYVENILNKDKDQLSVDKLRAFGF
                    ******************************