From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004460000
  • symbol?:
  • description?: pyridine nucleotide-disulfide oxidoreductase

      descriptions from strain specific annotations:

    • pyridine nucleotide-disulfide oxidoreductase
    • pyridine nucleotide-disulfide oxidoreductase family protein
  • strand?: -
  • coordinates?: 4706585..4708213
  • synteny block?: BlockID0034570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1727
    08BA02176:
    C248_1817
    11819-97:
    MS7_1775
    71193:
    ST398NM01_1823
    ECT-R 2:
    ECTR2_1609
    ED133:
    SAOV_1755
    ED98:
    SAAV_1782
    HO 5096 0412:
    SAEMRSA15_16780
    JH1:
    SaurJH1_1859
    JH9:
    SaurJH9_1824
    JKD6008:
    SAA6008_01744
    JKD6159:
    SAA6159_01692
    LGA251:
    SARLGA251_16590
    M013:
    M013TW_1785
    MRSA252:
    SAR1854
    MSHR1132:
    SAMSHR1132_16190
    MSSA476:
    SAS1695
    Mu3:
    SAHV_1757
    Mu50:
    SAV1772
    MW2:
    MW1712
    RF122:
    SAB1629c
    ST398:
    SAPIG1823
    T0131:
    SAT0131_01886
    TCH60:
    HMPREF0772_11382
    TW20:
    SATW20_17620
    USA300_TCH1516:
    USA300HOU_1761
    VC40:
    SAVC_08065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVAIIGMGTAGVSVLRELVKHPKFNQLDIDLYDDKVNMGQGVPFQNDSSELLINMPSKK
    N315            MRVAIIGMGTAGVSVLRELVKHPKFNQLDIDLYDDKVNMGQGVPFQNDSSELLINMPSKK
    NCTC8325        MRVAIIGMGTAGVSVLRELVKHPKFNQLDIDLYDDKVNMGQGVPFQNDSSELLINMPSKK
    Newman          MRVAIIGMGTAGVSVLRELVKHPKFNQLDIDLYDDKVNMGQGVPFQNDSSELLINMPSKK
    USA300_FPR3757  MRVAIIGMGTAGVSVLRELVKHPKFNQLDIDLYDDKVNMGQGVPFQNDSSELLINMPSKK
                    ************************************************************

    COL             MSLNLDDETEFWKWYKQQTDFNFDEPAYLPRFVFGHYMKSYLSMFTKKYPNISTNYNKVQ
    N315            MSLNLDDETEFWKWYKQQTDFNFDEPAYLPRFVFGHYMKSYLSMFTKKYPNISTNYNKVQ
    NCTC8325        MSLNLDDETEFWKWYKQQTDFNFDEPAYLPRFVFGHYMKSYLSMFTKKYPNISTNYNKVQ
    Newman          MSLNLDDETEFWKWYKQQTDFNFDEPAYLPRFVFGHYMKSYLSMFTKKYPNISTNYNKVQ
    USA300_FPR3757  MSLNLDDETEFWKWYKQQTDFNFDEPAYLPRFVFGHYMKSYLSMFTKKYPNISTNYNKVQ
                    ************************************************************

    COL             EIYTNSNIDETNLTYYICTTNSGQSWQAYDYVFLTCGTFAYHDPYNLKGKKGYIATPYPT
    N315            EIYTNSNIDETNLTYYICTTNSEQSWQAYDYVFLTCGTFAYHDPYNLKGKKGYIATPYPT
    NCTC8325        EIYTNSNIDETNLTYYICTTNSGQSWQAYDYVFLTCGTFAYHDPYNLKGKKGYIATPYPT
    Newman          EIYTNSNIDETNLTYYICTTNSGQSWQAYDYVFLTCGTFAYHDPYNLKGKKGYIATPYPT
    USA300_FPR3757  EIYTNSNIDETNLTYYICTTNSGQSWQAYDYVFLTCGTFAYHDPYNLKGKKGYIATPYPT
                    ********************** *************************************

    COL             YNTLDEVNELDDIAIIGTGLASLDVVRYVAAHHPKLPITMTSRSAHLPSVRGTMIDVTFK
    N315            YNTLDEVNELDDIAIIGTGLASLDVVRYVAAHHPKLPITMTSRSAHLPSVRGTMIDVTFK
    NCTC8325        YNTLDEVNELDDIAIIGTGLASLDVVRYVAAHHPKLPITMTSRSAHLPSVRGTMIDVTFK
    Newman          YNTLDEVNELDDIAIIGTGLASLDVVRYVAAHHPKLPITMTSRSAHLPSVRGTMIDVTFK
    USA300_FPR3757  YNTLDEVNELDDIAIIGTGLASLDVVRYVAAHHPKLPITMTSRSAHLPSVRGTMIDVTFK
                    ************************************************************

    COL             YLTKDKLNDIKKHHFGNAPLDTLVSLFLKECADYDIDFKKLVHRRTGNHIADLKYDLARP
    N315            YLTKDKLNDIKKHHFGNAPLDTIVSLFLKECAEYDIDFKKLVHRRTGNHIADLKYDLARP
    NCTC8325        YLTKDKLNDIKKHHFGNAPLDTLVSLFLKECAEYDIDFKKLVHRRTGNHIADLKYDLARP
    Newman          YLTKDKLNDIKKHHFGNAPLDTLVSLFLKECADYDIDFKKLVHRRTGNHIADLKYDLARP
    USA300_FPR3757  YLTKDKLNDIKKHHFGNAPLDTLVSLFLKECADYDIDFKKLVHRRTGNHIADLKYDLARP
                    **********************:*********:***************************

    COL             TEMGIFQSMIEHLKENLNWIWNSLSIEDQHQFNQKYSKMIQLNSNPMPPRTAELIIELIE
    N315            TEMGIFQSMIEHLKENLNWIWNSLSIEDQHQFNQKYSKMIQLNSNPMPPRTAELIIELIE
    NCTC8325        TEMGIFQSMIEHLKENLNWIWNSLSIEDQHQFNQKYSKMIQLNSNPMPPRTAELIIELIE
    Newman          TEMGIFQSMIEHLKENLNWIWNSLSIEDQHQFNQKYSKMIQLNSNPMPPRTAELIIELIE
    USA300_FPR3757  TEMGIFQSMIEHLKENLNWIWNSLSIEDQHQFNQKYSKMIQLNSNPMPPRTAELIIELIE
                    ************************************************************

    COL             NKSLILKKDLEDVKHDGKLYYFSYKNQESVDIYNVVINATGAKSHLNELDQDDQLIRNLE
    N315            NKSLILKKDLEDVKHDGKLYYFSYKNQESVDMYNVVINATGAKSHLNELDQDDQLIKNLE
    NCTC8325        NKSLILKKDLEDVKHDGKLYYFSYKNQESVDIYNVVINATGAKSHLNELDQDDQLIRNLE
    Newman          NKSLILKKDLEDVKHDGKLYYFSYKNQESVDIYNVVINATGAKSHLNELDQDDQLIRNLE
    USA300_FPR3757  NKSLILKKDLEDVKHDGKLYYFSYKNQESVDIYNVVINATGAKSHLNELDQDDQLIRNLE
                    *******************************:************************:***

    COL             NRQIVQAHPMGGIQIIPETNQVISPRFGTLTNMIAIGQMTNGVNKLRNGVKMIVEQVAHT
    N315            NRQIVQAHPMGGIQIIPETNQVISPRFGTLTNMIAIGQMTNGVNKLRNGVKMIVEQVAHT
    NCTC8325        NRQIVQAHPMGGIQIIPETNQVISPRFGTLTNMIAIGQMTNGVNKLRNGVKMIVEQVAHT
    Newman          NRQIVQAHPMGGIQIIPETNQVISPRFGTLTNMIAIGQMTNGVNKLRNGVKMIVEQVAHT
    USA300_FPR3757  NRQIVQAHPMGGIQIIPETNQVISPRFGTLTNMIAIGQMTNGVNKLRNGVKMIVEQVAHT
                    ************************************************************

    COL             VSQLYDALESNEQQQRSDNQ
    N315            VSQLYDALESNEQQQRSYNQ
    NCTC8325        VSQLYDALESNEQQQRSDNQ
    Newman          VSQLYDALESNEQQQRSDNQ
    USA300_FPR3757  VSQLYDALESNEQQQRSDNQ
                    ***************** **