From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004482000
  • symbol?: crcB1
  • description?: camphor resistance protein CrcB

      descriptions from strain specific annotations:

    • camphor resistance protein CrcB
    • crcB protein
    • CrcB family protein
    • crcB-like family protein
    • CrcB-like protein
    • intergral membrane protein
    • Protein crcB 1
    • protein crcB-like protein
    • Protein CrcB -like protein 1
  • strand?: +
  • coordinates?: 4721882..4722332
  • synteny block?: BlockID0034780
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1832 (crcB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1738 (crcB)
    08BA02176:
    C248_1830
    11819-97:
    MS7_1785
    71193:
    ST398NM01_1834
    ECT-R 2:
    ECTR2_1619
    ED133:
    SAOV_1767
    ED98:
    SAAV_1793 (crcB)
    HO 5096 0412:
    SAEMRSA15_16930
    JH1:
    SaurJH1_1870
    JH9:
    SaurJH9_1835
    JKD6008:
    SAA6008_01753 (crcB)
    JKD6159:
    SAA6159_01704 (crcB)
    LGA251:
    SARLGA251_16700
    M013:
    M013TW_1796
    MRSA252:
    SAR1866
    MSHR1132:
    SAMSHR1132_16310
    MSSA476:
    SAS1706
    Mu3:
    SAHV_1768
    Mu50:
    SAV1783
    MW2:
    MW1723
    RF122:
    SAB1641
    ST398:
    SAPIG1834 (crcB)
    T0131:
    SAT0131_01898
    TCH60:
    HMPREF0772_11370 (crcB)
    TW20:
    SATW20_17730
    USA300_TCH1516:
    USA300HOU_1772 (crcB)
    VC40:
    SAVC_08130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHRQFLSSRCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTL
    N315            MHRQFLSSCCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTL
    NCTC8325        --------------------------MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTL
    Newman          MHRQFLSSRCQNLFFKFKLLLFEVNQMQYVYIFIGGALGALLRYLISFLNTDGGFPIGTL
                                              **********************************

    COL             IANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFIT
    N315            IANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFIT
    NCTC8325        IANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFIT
    Newman          IANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFIT
                    ************************************************************

    COL             LLLYAVTSYVFGILLCYVGIKLGGGLS
    N315            LLLYAVTSYVFGILLCYVGIKLGGGLS
    NCTC8325        LLLYAVTSYVFGILLCYVGIKLGGGLS
    Newman          LLLYAVTSYVFGILLCYVGIKLGGGLS
                    ***************************