From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004508000
  • symbol?:
  • description?: Low G+C gram positive nudix hydrolase YtkD

      descriptions from strain specific annotations:

    • Low G+C gram positive nudix hydrolase YtkD
    • nucleoside triphosphatase YtkD
    • phosphohydrolase
    • putative hydrolase
    • NUDIX family hydrolase
    • MutT/nudix family protein
    • MutT/NUDIX hydrolase family protein
  • strand?: -
  • coordinates?: 4738154..4738627
  • synteny block?: BlockID0034990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1749 (ytkD)
    08BA02176:
    C248_1838
    11819-97:
    MS7_1792 (ytkD)
    71193:
    ST398NM01_1841
    ECT-R 2:
    ECTR2_1628 (ytkD)
    ED133:
    SAOV_1774
    ED98:
    SAAV_1803
    HO 5096 0412:
    SAEMRSA15_17010
    JH1:
    SaurJH1_1880
    JH9:
    SaurJH9_1844
    JKD6008:
    SAA6008_01769
    JKD6159:
    SAA6159_01711
    LGA251:
    SARLGA251_16770
    M013:
    M013TW_1803
    MRSA252:
    SAR1874
    MSHR1132:
    SAMSHR1132_16380
    MSSA476:
    SAS1714
    Mu3:
    SAHV_1779
    Mu50:
    SAV1794
    MW2:
    MW1732
    RF122:
    SAB1648c
    ST398:
    SAPIG1841 (ytkD)
    T0131:
    SAT0131_01909
    TCH60:
    HMPREF0772_11363 (ytkD)
    TW20:
    SATW20_17830
    USA300_TCH1516:
    USA300HOU_1781
    VC40:
    SAVC_08180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVKFRDKDNRQVNLTFKKDNEIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGE
    N315            MRVKFRDKDNRQVNLTFKKDNEIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGE
    NCTC8325        --MKFRDKDNRQVNLTFKKDNEIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGE
    Newman          MRVKFRDKDNRQVNLTFKKDNEIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGE
    USA300_FPR3757  MRVKFRDKDNRQVNLTFKKDNEIADGNHVLAIPTFKNQLLFTKHNLRGIEFPGGKRERGE
                      :*********************************************************

    COL             SSAEAVTRELYEETGAKVKNIYYIAQYTIETHDQTDFVKDVYFIEVESLVSKNDYLETAG
    N315            SSAEAVTRELYEETGAKVKNIHYIAQYTIETHDQTDFVKDVYFIEVESLVSKNDYLETAG
    NCTC8325        SSAEAVTRELYEETGAKVKNIYYIAQYTIETHDQTDFVKDVYFIEVESLVSKNDYLETAG
    Newman          SSAEAVTRELYEETGAKVKNIYYIAQYTIETHDQTDFVKDVYFIEVESLVSKNDYLETAG
    USA300_FPR3757  SSAEAVTRELYEETGAKVKNIYYIAQYTIETHDQTDFVKDVYFIEVESLVSKNDYLETAG
                    *********************:**************************************

    COL             PVLFNCINDIELAQRSFLLQDSTILKCVERVQSLGFYQT
    N315            PVLFNCINDIELAQRSFLLQDSTILKCVERVQSLGFYQT
    NCTC8325        PVLFNCINDIELAQRSFLLQDSTILKCVERVQSLGFYQT
    Newman          PVLFNCINDIELAQRSFLLQDSTILKCVERVQSLGFYQT
    USA300_FPR3757  PVLFNCINDIELAQRSFLLQDSTILKCVERVQSLGFYQT
                    ***************************************