From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004514000
  • symbol?:
  • description?: calcium-binding protein

      descriptions from strain specific annotations:

    • calcium-binding protein
    • putative lipoprotein
    • endonuclease
    • excalibur calcium-binding domain protein
    • excalibur domain-containing protein
    • excalibur domain protein
    • Excalibur extracellular calcium-binding domain protein
    • pseudogene
  • strand?: +
  • coordinates?: 4742352..4743178
  • synteny block?: BlockID0035050
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1754
    08BA02176:
    C248_1843
    11819-97:
    MS7_1797
    71193:
    ST398NM01_1867
    ECT-R 2:
    ECTR2_1633
    ED133:
    SAOV_1779
    ED98:
    SAAV_1808
    HO 5096 0412:
    SAEMRSA15_17060
    JH1:
    SaurJH1_1885
    JH9:
    SaurJH9_1849
    JKD6008:
    SAA6008_01774
    JKD6159:
    LGA251:
    SARLGA251_16820
    M013:
    M013TW_1808
    MRSA252:
    SAR1879
    MSHR1132:
    MSSA476:
    SAS1719
    Mu3:
    SAHV_1784
    Mu50:
    SAV1799
    MW2:
    MW1737
    RF122:
    SAB1653
    ST398:
    SAPIG1867
    T0131:
    SAT0131_01915
    TCH60:
    HMPREF0772_11358
    TW20:
    SATW20_17880
    USA300_TCH1516:
    USA300HOU_1786
    VC40:
    SAVC_08205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKITYKYRGDLPLNTENNKNQNQSVKNSERRGMLKGCGGCLISFILLIILLSACSMMFSN
    N315            ------------MNTENNKNQNQSVKNSERRGMLKGCGGCLISFILLIILLSACSMMFSN
    NCTC8325        MKITYKYRGDLPLNTENNKNQNQSVKNSERRGMLKGCGGCLISFILLIILLSACSMMFSN
    USA300_FPR3757  MKITYKYRGDLPLNTENNKNQNQSVKNSERRGMLKGCGGCLISFILLIILLSACSMMFSN
                                :***********************************************

    COL             NDNSTNNQSSKTQLTQKDENKNEDKPEEKSETATDEDLQSTEEVPANENTENNQHEIDEI
    N315            NDNSTSNQSSKTQLTQKDENKNEDKPEEKSETATDEDLQSTEEVPANENTENNQHEIDEI
    NCTC8325        NDNSTNNQSSKTQLTQKDENKNEDKPEEKSETATDEDLQSTEEVPANENTENNQHEIDEI
    USA300_FPR3757  NDNSTNNQSSKTQLTQKDENKNEDKPEEKSETATDEDLQSTEEVPANENTENNQHEIDEI
                    *****.******************************************************

    COL             TTKDQSDDDINTPNVAEDKSQDDLKDDLKEKQQSSNHHQSTQPKTSPSTETNTQQSFANC
    N315            TTKDQSDDEINTPNVAEDKSQDDLKDDLKEKQQSSNHHQSTQPKTSPSTETNRQQSFANC
    NCTC8325        TTKDQSDDDINTPNVAEDKSQDDLKDDLKEKQQSSNHHQSTQPKTSPSTETNTQQSFANC
    USA300_FPR3757  TTKDQSDDDINTPNVAEDKSQDDLKDDLKEKQQSSNHHQSTQPKTSPSTETNTQQSFANC
                    ********:******************************************* *******

    COL             KQLRQVYPNGVTADHPAYRPHLDRDKDKRACEPDKY
    N315            KQLRQVYPNGVTADHPAYRPHLDRDKDNRACEPDKN
    NCTC8325        KQLRQVYPNGVTADHPAYRPHLDRDKDKRACEPDKY
    USA300_FPR3757  KQLRQVYPNGVTADHPAYRPHLDRDKDKRACEPDKY
                    ***************************:*******