From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004570000
  • symbol?:
  • description?: beta-lactamase

      descriptions from strain specific annotations:

    • beta-lactamase
    • ear protein
    • putative beta-lactamase
  • strand?: +
  • coordinates?: 4804018..4804584
  • synteny block?: BlockID0035580
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1770
    08BA02176:
    11819-97:
    MS7_1815
    71193:
    ECT-R 2:
    ECTR2_1646
    ED133:
    SAOV_1799
    ED98:
    SAAV_1822
    HO 5096 0412:
    JH1:
    SaurJH1_1900
    JH9:
    SaurJH9_1866
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_16980
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1738
    Mu3:
    SAHV_1800
    Mu50:
    SAV1815
    MW2:
    MW1757
    RF122:
    SAB1675
    ST398:
    T0131:
    SAT0131_01934
    TCH60:
    TW20:
    SATW20_18120
    USA300_TCH1516:
    USA300HOU_1807
    VC40:
    SAVC_08310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTKFLGKTLVASALVLTTLGTGLHSSYLGLDTNKVVKTAKAEEKMTDGQLWKKVKDSLH
    N315            MNTKFLGKTLVASALVLTTLGTGLHSSYLGLNTNKVVKTAKAEEKMTNGQLWKKVKDSLI
    NCTC8325        MNTKFLGKTLVASALVLTTLGTGLHSSYLGLDTNKVVKTAKAEEKMTDGQLWKKVKDSLH
    Newman          MNTKFLGKTLVASALVLTTLGTGLHSSYLGLDTNKVVKTAKAEEKMTDGQLWKKVKDSLH
    USA300_FPR3757  MNTKFLGKTLVASALVLTTLGTGLHSSYLGLDTNKVVKTAKAEEKMTDGQLWKKVKDSLH
                    *******************************:***************:*********** 

    COL             DSDIILSNEYETINVTYLLSNGYSSSVSAPGNDDGGHLTQSIDFKGLKQIDLTKENV-YD
    N315            DSNIISGNENEEITVTYVNKTGYSSSVSAYGNNNDDFSSTPSNFSKLKEIDLKKDNVPSD
    NCTC8325        DSDIILSNEYETINVTYLLSNGYSSSVSAPGNDDGGHLTQSIDFKGLKQIDLTKENV-YD
    Newman          DSDIILSNEYETINVTYLLSNGYSSSVSAPGNDDGGHLTQSIDFKGLKQIDLTKENV-YD
    USA300_FPR3757  DSDIILSNEYETINVTYLLSNGYSSSVSAPGNDDGGHLTQSIDFKGLKQIDLTKENV-YD
                    **:** .** * *.***: ..******** **::... : . :*. **:***.*:**  *

    COL             DFNKKLDAKNTWNSLTEKLKGLGLLQNGQKVSIYSSDSS----SPVSGKVGEGVTSGGEN
    N315            DFNTTVSGEDSWKTLTSKLKEKGLVTDGQTVTIHCNDKSDNTKSSVSGKVGADLTSGNGT
    NCTC8325        DFNKKLDAKNTWNSLTEKLKGLGLLQNGQKVSIYSSDSS----SPVSGKVGEGVTSGGEN
    Newman          DFNKKLDAKNTWNSLTEKLKGLGLLQNGQKVSIYSSDSS----SPVSGKVGEGVTSGGEN
    USA300_FPR3757  DFNKKLDAKNTWNSLTEKLKGLGLLQNGQKVSIYSSDSS----SPVSGKVGEGVTSGGEN
                    ***..:..:::*::**.***  **: :**.*:*:..*.*    *.****** .:***. .

    COL             TLTKRFINKITID
    N315            TFKKRFIDKITID
    NCTC8325        TLTKRFINKITID
    Newman          TLTKCFINKITID
    USA300_FPR3757  TLTKRFINKITID
                    *:.* **:*****