From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN004574000
  • symbol?: epiF
  • description?: epidermin immunity protein F

      descriptions from strain specific annotations:

    • epidermin immunity protein F
    • lantibiotic epidermin immunity protein F
    • ABC transporter
    • lantibiotic immunity protein F
    • epidermin ABC transporter ATP-binding protein
    • lantibiotic transport ATP-binding protein
    • lantibiotic protection ABC transporter ATP-binding subunit
    • transport protein
  • strand?: -
  • coordinates?: 4806511..4807203
  • synteny block?: BlockID0035600
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1873 (epiF)
    N315:
    NCTC8325:
    Newman:
    NWMN_1711 (bsaF)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1818
    71193:
    ECT-R 2:
    ED133:
    SAOV_1802
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_17010
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1741
    Mu3:
    Mu50:
    MW2:
    MW1760 (bsaF)
    RF122:
    SAB1678c
    ST398:
    T0131:
    SAT0131_01939
    TCH60:
    TW20:
    SATW20_18150
    USA300_TCH1516:
    USA300HOU_1810 (epiF)
    VC40:
    SAVC_08325

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MAKLVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSG
    NCTC8325        --MAKLVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSG
    Newman          MIMAKLVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSG
    USA300_FPR3757  --MAKLVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSG
                      **********************************************************

    COL             EIKLDNRPMTRNDLHKVGSLIETPATYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLN
    NCTC8325        EIKLDNRPMTRNDLHKVGSLIETPATYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLN
    Newman          EIKLDNRPMTRNDLHKVGSLIETPATYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLN
    USA300_FPR3757  EIKLDNRPMTRNDLHKVGSLIETPATYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLN
                    ************************************************************

    COL             VDKKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGIQELRELLKLLTEQGT
    NCTC8325        VDKKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGIQELRELLKLLTEQGT
    Newman          VDKKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGIQELRELLKLLTEQGT
    USA300_FPR3757  VDKKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGIQELRELLKLLTEQGT
                    ************************************************************

    COL             SIIISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITKGDYK
    NCTC8325        SIIISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITKGDYK
    Newman          SIIISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITKGDYK
    USA300_FPR3757  SIIISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITKGDYK
                    ****************************************************