From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1711 [new locus tag: NWMN_RS09610 ]
  • pan locus tag?: SAUPAN004574000
  • symbol: bsaF
  • pan gene symbol?: epiF
  • synonym:
  • product: lantibiotic immunity protein F

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1711 [new locus tag: NWMN_RS09610 ]
  • symbol: bsaF
  • product: lantibiotic immunity protein F
  • replicon: chromosome
  • strand: -
  • coordinates: 1907666..1908364
  • length: 699
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGATTATGGCAAAATTAGTTACTGAAAACATTTCGAAGCGGTTTAAAAATCAAGATGTA
    TTAAAGCATATTAATATCACTTTAGAAAATAACGAAGTTTATGGATTACTTGGTATTAAT
    GGAGCCGGTAAAACGACACTTATGAAAATTATATGTGGCATACTTCAACAAGATTCAGGG
    GAAATTAAATTAGATAATAGACCAATGACACGAAATGATTTGCACAAAGTTGGTTCGCTT
    ATTGAAACACCTGCGACATATAATCATTTAAGTGCACAAGATAATTTGAAAATTGTGTGT
    TTAAATGAAAGCGTTGATTTCAGCGAAATTAATAGTGTTTTAAGCTTAGTCAATTTAAAT
    GTCGATAAAAAGAAAAAGGTTAAGGACTTTTCTTTAGGTATGAAACAAAGACTTGGAATT
    GCAATGGCATTAATTAAAAAGCCAGAAATTTTAGTATTAGACGAACCATCTAATGGTTTA
    GACCCATATGGAATCCAAGAACTTAGAGAACTTCTAAAATTATTAACAGAACAAGGTACT
    AGTATTATTATTTCAAGTCACATTTTATCTGAAATCCAAGTTTTAGCAGATCATATCGGT
    ATTATTCATGAGGGTGAGCTAAAATATCAGCAAAGAAATAACAAAGATGAAAACTTAGAA
    GAGATATTCTTCAAAATAACGAAAGGTGATTACAAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    699

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1711 [new locus tag: NWMN_RS09610 ]
  • symbol: BsaF
  • description: lantibiotic immunity protein F
  • length: 232
  • theoretical pI: 6.79888
  • theoretical MW: 26135.2
  • GRAVY: -0.228017

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 364)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 152.1)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 141.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 134.7)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 134.7)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 120)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 111.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 110.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 109.7)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 109.4)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 107.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 106.2)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 102.3)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 102.3)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 102.3)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 99.9)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 99.7)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 98.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 95.9)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 95.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 95.6)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 95.3)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 95.3)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 94.2)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 87.4)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 87.2)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 87.2)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 86.1)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 84.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 83.9)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 82.5)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 81.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 80.6)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 79.9)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 79.4)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 79.4)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 79.1)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 78.3)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 76.8)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 76.8)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 76.7)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 76.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 76.6)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 75.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 73.4)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 72.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 72.7)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 67.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 67.5)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 67.5)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 66.2)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 65.8)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 65.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 65.1)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 65.1)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 65.1)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 64.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 58.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 58.4)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 57.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 57.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 54.3)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 54.3)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 54.3)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 42.3)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 39)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 35.9)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 33.8)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 28.4)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 17.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 15.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 15.1)
    Signal transductionRegulatory functionsProtein interactionsLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 15.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 14.6)
    MetabolismEnergy metabolismAmino acids and aminesL-serine ammonia-lyase (TIGR00720; EC 4.3.1.17; HMM-score: 12.1)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisL-serine ammonia-lyase (TIGR00720; EC 4.3.1.17; HMM-score: 12.1)
  • TheSEED:  
    Bacitracin transport ATP-binding protein bcrA 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 103.2)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 53.7)
    AAA_23; AAA domain (PF13476; HMM-score: 28.3)
    AAA_30; AAA domain (PF13604; HMM-score: 20.2)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 19.5)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.6)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 15.9)
    AAA_22; AAA domain (PF13401; HMM-score: 15.9)
    AAA_14; AAA domain (PF13173; HMM-score: 15.6)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 14.7)
    AAA_13; AAA domain (PF13166; HMM-score: 14.2)
    ArgK; ArgK protein (PF03308; HMM-score: 14.1)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.1)
    no clan definedSDH_beta; Serine dehydratase beta chain (PF03315; HMM-score: 12.8)
    P-loop_NTPase (CL0023) AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.15
    • Ymax_pos: 18
    • Cmax: 0.108
    • Cmax_pos: 65
    • Smax: 0.257
    • Smax_pos: 11
    • Smean: 0.207
    • D: 0.172
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIMAKLVTENISKRFKNQDVLKHINITLENNEVYGLLGINGAGKTTLMKIICGILQQDSGEIKLDNRPMTRNDLHKVGSLIETPATYNHLSAQDNLKIVCLNESVDFSEINSVLSLVNLNVDKKKKVKDFSLGMKQRLGIAMALIKKPEILVLDEPSNGLDPYGIQELRELLKLLTEQGTSIIISSHILSEIQVLADHIGIIHEGELKYQQRNNKDENLEEIFFKITKGDYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] [2] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]