From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1709 [new locus tag: NWMN_RS15000 ]
  • pan locus tag?: SAUPAN004572000
  • symbol: bsaG
  • pan gene symbol?: epiG
  • synonym:
  • product: lantibiotic ABC transporter protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1709 [new locus tag: NWMN_RS15000 ]
  • symbol: bsaG
  • product: lantibiotic ABC transporter protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1906213..1906923
  • length: 711
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGGCGATTAAAATGATAATTAACGAATTAAAGTCATGTAAGTTGAAATTTTCTAAGCAA
    GCGCTCACATTTGTACCCATTATTGTAACCATATTGTTTATATTATTTATAAATTGGTAT
    TTAAACGTAAATTTATGGAATGGTCGACAAATAAGTTTGTTTACAGCGAGTTTTAATGCA
    ATTACATCGCTATTAATTTCTATAAACGTCTATCAAGTTATCAATTTTGAAGAAAATATT
    GGTCACTTTAATCATATTTTAGGAAAAGCTAATAGGCTAAATTGGTTAAATGCATCAATG
    ATTTTTACTTATACTATTACAGCCATATGTATTCTATTAGCATCAATTAATTTATTGTGG
    CATTCACATGATATGAAAATAACACTTATGTTTATAGGCGTATCATTGTTTTTCAATGTA
    ATTATATTACTGCTACTTTTTATTTTTAGTATTTTCATTAAAGATGTAATGGCTATTGTT
    GTCGGAGTTTTAATGTTTATTTTTAACGTTTATTTTGGATTAGAAGTGCTTGGAGATCAT
    TCGTGGTTCTATTTACCAATCACATATGCTACACGTTACGTTTATATGTTTATCGAAGGG
    AGTATACCAGTTACATTAACATTGGCAATCTATATTATTATCACGTTGCTATTAGCAGTT
    TTACTCTTTAAAGGATTTAATAAATGGAGCGGTAGAACAATTAAAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    711

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1709 [new locus tag: NWMN_RS15000 ]
  • symbol: BsaG
  • description: lantibiotic ABC transporter protein
  • length: 236
  • theoretical pI: 9.67085
  • theoretical MW: 27217.7
  • GRAVY: 1.02119

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    lantibiotic protection ABC transporter permease subunit, MutG family (TIGR03733; HMM-score: 36.9)
  • TheSEED:  
    BsaG protein 
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.212
    • Ymax_pos: 17
    • Cmax: 0.11
    • Cmax_pos: 57
    • Smax: 0.558
    • Smax_pos: 10
    • Smean: 0.404
    • D: 0.287
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAIKMIINELKSCKLKFSKQALTFVPIIVTILFILFINWYLNVNLWNGRQISLFTASFNAITSLLISINVYQVINFEENIGHFNHILGKANRLNWLNASMIFTYTITAICILLASINLLWHSHDMKITLMFIGVSLFFNVIILLLLFIFSIFIKDVMAIVVGVLMFIFNVYFGLEVLGDHSWFYLPITYATRYVYMFIEGSIPVTLTLAIYIIITLLLAVLLFKGFNKWSGRTIKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]