From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004781000
  • symbol?: airR
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • LuxR family DNA-binding response regulator
    • two-component response regulator-like protein
    • bacterial regulatory s, luxR family protein
    • putative response regulator
    • response regulator protein
    • response regulator receiver
    • two component LuxR family transcriptional regulator
    • two-component response regulator protein
    • two-component response regulator receiver protein
  • strand?: -
  • coordinates?: 4991074..4991697
  • synteny block?: BlockID0037130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1804
    08BA02176:
    C248_1891
    11819-97:
    MS7_1853
    71193:
    ST398NM01_1914
    ECT-R 2:
    ECTR2_1690
    ED133:
    SAOV_1845
    ED98:
    SAAV_1867
    HO 5096 0412:
    SAEMRSA15_17530
    JH1:
    SaurJH1_1936
    JH9:
    SaurJH9_1902
    JKD6008:
    SAA6008_01805 (yhcR)
    JKD6159:
    SAA6159_01776 (yhcR)
    LGA251:
    SARLGA251_17310 (yhcR)
    M013:
    M013TW_1854
    MRSA252:
    SAR1939
    MSHR1132:
    SAMSHR1132_16940
    MSSA476:
    SAS1769
    Mu3:
    SAHV_1833 (yhcR)
    Mu50:
    SAV1848
    MW2:
    MW1789
    RF122:
    SAB1781c
    ST398:
    SAPIG1914
    T0131:
    SAT0131_01968
    TCH60:
    HMPREF0772_11296 (vraR2)
    TW20:
    SATW20_18420 (yhcR)
    USA300_TCH1516:
    USA300HOU_1842
    VC40:
    SAVC_08480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG
    N315            MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG
    NCTC8325        MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG
    Newman          MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG
    USA300_FPR3757  MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG
                    ************************************************************

    COL             MNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVM
    N315            MNGIEITEYIKAHYPEIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVM
    NCTC8325        MNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVM
    Newman          MNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVM
    USA300_FPR3757  MNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVM
                    ***************:********************************************

    COL             NGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKT
    N315            NGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKT
    NCTC8325        NGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKT
    Newman          NGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKT
    USA300_FPR3757  NGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKT
                    ************************************************************

    COL             HVSHIFSKLQVSDRTQAAIYAMENKLI
    N315            HVSHIFSKLQVSDRTQAAIYAMENKLI
    NCTC8325        HVSHIFSKLQVSDRTQAAIYAMENKLI
    Newman          HVSHIFSKLQVSDRTQAAIYAMENKLI
    USA300_FPR3757  HVSHIFSKLQVSDRTQAAIYAMENKLI
                    ***************************