From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004790000
  • symbol?:
  • description?: glucosamine-6-phosphate isomerase

      descriptions from strain specific annotations:

    • glucosamine-6-phosphate isomerase
    • glucosamine-6-phosphate deaminase
    • glucosamine-6-phosphate isomerase family protein
    • membrane protein
  • strand?: -
  • coordinates?: 4997848..4998447
  • synteny block?: BlockID0037220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1810
    08BA02176:
    C248_1898
    11819-97:
    MS7_1859
    71193:
    ST398NM01_1920
    ECT-R 2:
    ECTR2_1696
    ED133:
    SAOV_1851
    ED98:
    SAAV_1873
    HO 5096 0412:
    SAEMRSA15_17590
    JH1:
    SaurJH1_1942
    JH9:
    SaurJH9_1908
    JKD6008:
    SAA6008_01811
    JKD6159:
    SAA6159_01783
    LGA251:
    SARLGA251_17370
    M013:
    M013TW_1860
    MRSA252:
    SAR1945
    MSHR1132:
    SAMSHR1132_17000
    MSSA476:
    SAS1777
    Mu3:
    SAHV_1839
    Mu50:
    SAV1854
    MW2:
    MW1795
    RF122:
    SAB1788c
    ST398:
    SAPIG1920
    T0131:
    SAT0131_01974
    TCH60:
    HMPREF0772_11290
    TW20:
    SATW20_18480
    USA300_TCH1516:
    USA300HOU_1849
    VC40:
    SAVC_08520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDF
    N315            MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDF
    NCTC8325        MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDF
    Newman          MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDF
    USA300_FPR3757  MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDF
                    ************************************************************

    COL             SQINILDYDDKKSYFEALGVPAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDE
    N315            SQINILDYDDKKSYFEALGVPAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDE
    NCTC8325        SQINILDYDDKKSYFEALGVPAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDE
    Newman          SQINILDYDDKKSYFEALGVPAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDE
    USA300_FPR3757  SQINILDYDDKKSYFEALGVPAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDE
                    ************************************************************

    COL             QGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGKTSFEPADLKAHRMVNVILDK
    N315            QGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGKTSFEPADLKAHRMVNVILDK
    NCTC8325        QGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGKTSFEPADLKAHRMVNVILDK
    Newman          QGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGKTSFEPADLKAHRMVNVILDK
    USA300_FPR3757  QGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGKTSFEPADLKAHRMVNVILDK
                    ************************************************************

    COL             EAAAGLPEDVKAYFTSRFA
    N315            EAAAGLPEDVKAYFTSRFA
    NCTC8325        EAAAGLPEDVKAYFTSRFA
    Newman          EAAAGLPEDVKAYFTSRFA
    USA300_FPR3757  EAAAGLPEDVKAYFTSRFA
                    *******************